Entry information : BaDyPrx11
Entry ID 10232
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-01 (Catherine Mathe)
Peroxidase information: BaDyPrx11
Name BaDyPrx11
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Meruliaceae Bjerkandera
Organism Bjerkandera adusta    [TaxId: 5331 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BaDyPrx11
start..stop
S start..stop
TcuDyPrx01 880 0 1..496 1..497
BaDyPrx03 880 0 1..496 1..497
BaDyPrx09 874 0 1..496 1..495
BaDyPrx02 749 0 1..497 1..495
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 112466..112577 112 N° 2 112312..112408 97 N° 3 112095..112257 163 N° 4 110455..110628 174
N° 5 110293..110407 115 N° 6 109665..110237 573 N° 7 109545..109611 67 N° 8 109296..109488 193
complement(join(109296..109488,109545..109611,109665..110237,110293..110407,1104 55..110628,112095..112257,112312..112408,112466..112577))


exon

Literature and cross-references BaDyPrx11
DNA ref. JGI genome:   scaffold_20 (112577..109296)
Cluster/Prediction ref. JGI gene:   457625
Protein sequence: BaDyPrx11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   497 (475)
PWM (Da):   %s   53316.77 (51018.5)  
PI (pH):   %s   5.08 (4.87) Peptide Signal:   %s   cut: 23 range:23-497
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLPLFVVSVAVFIGSSTHVSAARLGARQSRTTPLLTSFPGQAPLPSMEQHANQRGANILPLDNIQGDILIGMKKQKERFVFFHVNDAASFKSALKTYVPERITSAATLISDPAQQPFIRENPYRAPGTRNQLGITDNMGDAQFPNGQFADAAALGDDISQWVAPFTGTTVHGVFLIGSDQDDFLDQFTDDISSAFGASITQVQALSGSARPGDQAGHEHFGFLDGISQPAVTGWETTVFPGQAVVPPGIILTGRDGDTGTRPSWALDGSFMAFQHFQQKVPEFNAYTLANAIPANSAGNLTQQEGAEFLGARMFGRWKSGAPIDLAPTADDPALGVDLQRNNDFDYSDTLTDQIKCPFGAHVRKTNPRQDLGGPVNTFHAIRSSIPYGPETSNAELASGVTSQDRGLLFVEYQSIIANGFRFQQINWANNANFPFSKPVVPGIEPIIGQASPRTVSGLDPLDQTKTFTVPLFVIPKGGEYFFMPSISALTSTIAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCTTCCGCTGTTTGTTGTGTCGGTCGCTGTATTCATCGGGTCGAGCACCCATGTCTCTGCTGCCAGACTCGGTGCGAGGCAGTCGCGCACAACGCCTCTCCTCACCAGTATGCTA
TCATATTGTTCCACTTTTACGGGGCCACCTCTAACTTCGCACGTCCCAGGCTTTCCTGGGCAAGCCCCGCTACCTTCCATGGAGCAACACGCAAATCAAAGGGGCGCTAACATCTTGCCG
CTGGATAACATCCAAGGCGATATCTT
GTGTGTTTCTTTCCCATTCTTTCGCATCTACGTCCATTACTGATAATCATCCAGGATCGGAATGAAGAAACAGAAAGAACGCTTCGTCTTCTTC
CACGTCAATGACGCGGCCTCTTTCAAGTCGGCGTTGAAGACCTACGTACCTGAGCGCATCACGTCGGCGGCGACTCTGATTTCAGATCCCGCTCAGCAGCCGTTCATCAGGGAAAACCCC
CCC
GTATAATTAGCAATAAAAAGGTGTAATTATCAGCATTACCTTGAAACTATACATTATCACGAATAGTTTAGTCCCCCTTTTAAACTGGTCCTAATTAATCACATTATCGCACGTTAT
CAAGGTATTGAAACACATTATATTGGATCTATACTACGGCTACATTGCGGTGCTATCGTCCACTACTACTCGTTTCTCATCACCCAGAGAAGTACATCAAGCCAGCAGGATGTACAGCCA
GCATGCCAGCGCCGAGGCCTTCAAACTACACACGTCCCGATGTTAGTCTCTGGAGATGTCTAGAATGCTGAGATGTGCGTACCATGCGTTGCGGCTGATTGCAACTTTTCATCCATGCGG
CGGGGAGTAGAGCTTAAGGTACTAGTACGCGGGCATGGAGAGCCGCAACGGCACAGCGAGCTTCTTCAGTATGTCCGCGATACACTCGTGGCAGTCCGAAGATCTCTAATAATCAACAAC
TGATTAGACCTGTATAGTGCAGGCGGGAGCATCCACATACCTTGGCAGGGAAGAGGAAGACAGGTGTACCATGAACAGGTCGCAGCAGACTTTAATCCCTTCTCAGTATGTGATTACAGG
CACGAGTTCGAGCGTACTTACATGTTCTAAACAGACGCGGAGATCGGATGCCGACCTAGGGATACATTACTCGGGCCCGGAGACAATACACTCGTAGAATGGTGACGTACCTTGCCCATA
TCCATCCAATAAAGGCCTGTTTCGCGCGCAGCTGCACAGCGACGATGACCAAGGCCGTGAAAGCCCTCAAGTTGCGCGTTGACCGGCCGTCTGACTGGAATTACGAGGGTTAGAAGATGG
GCGTGAGATGCGGTGAAAGTGGAGGGTATATGCATAAAGCGCAAAGACGGCACCATTCTTGCGTGGGTAACGTCGTCACAATTTGAGGTCGAGGAGACAATCGAGCGACACATTGTCGGA
CTTGGTGCAATGAGTTGAGATCCCAGCGCCGTGTGGAAGGTGAGCGATTGGCCCTGATGACCGTGAGCAATACGTGTTGCACTAGTGAGCAGGAGGGAGGGGAAGGGGAAGGGGAAGGGG
AAGGGGAAGGGGAAGGGGAAGGCACGCAAAGACGAACGAGACGCGAAAACGAAGATGTTTGCCGGACATTGCCGGGGACGATTGCGTGATCAGTGGCCAATCATGAAGCAGCGCCTCATC
TCGCCGATCCCCCTGGCCTACCTCCGACGGTATGGAGTGTCCGCTCACACTGTCCGTCATGCGCACCTCCGGCACTTTCGTAACATGCGACTCGGCACAAGATTCATGTGAGCATGATTT
TACAGCTTTTCTCGACCCGCTAAAATAATGTAAGATAATCACGATAATTATCGCTCTTAACCAGGACTATCCCGGCGTGACATAATTAGTAGTAATTATATTGGGGGGTTTTCCCTGATG
TTGGCATTCGTCAACCTGGCCTTCTCAAGTACCGGGCTCCAGGCACTCGGAATCAACTCGGAATTACAGACAATATGGGCGACGCACAATTCCCCAATGGTCAGTTCGCGGACGCCGCCG
CCCTCGGGGACGATATCAGTCAATGGGTGGCGCCTTTCACCGGCACCACTGTCCACGGTGTCTTTTTGATTGGTAGCGACCAG
GTGAGTGCAGTCAAGAGCCTACTGCGAATTCGCTAAT
TCTTTGGTAGGATGATTTCTTGGATCAGTTCACAGACGATATCTCGTCGGCCTTCGGAGCCTCAATCACCCAGGTGCAGGCGCTGAGCGGCTCCGCTCGTCCAGGAGACCAAGCCGGCCA
CGAGC
GTAAGTTGCTCTTTATCATCCCTCGCTTGAGCATGCAATCTCATACCATCTGCAGACTTTGGCTTCCTCGACGGCATCTCGCAGCCCGCCGTCACAGGTTGGGAGACGACCGTCT
TCCCCGGACAGGCAGTTGTTCCGCCAGGAATTATCCTCACTGGGCGCGACGGCGACACGGGCACCCGTCCGTCATGGGCTCTCGACGGCAGTTTCATGGCGTTCCAGCACTTCCAGCAAA
AAGTCCCCGAGTTCAACGCCTACACGCTGGCCAACGCTATTCCGGCCAACAGTGCAGGCAATCTCACTCAGCAGGAAGGTGCAGAATTCCTCGGCGCACGCATGTTTGGTCGCTGGAAGA
GTGGCGCGCCAATCGATCTCGCACCAACGGCAGACGACCCTGCGCTCGGCGTTGACCTCCAGAGGAACAATGACTTCGACTACTCGGATACGCTGACGGACCAGATCAAGTGCCCCTTCG
GCGCACACGTGAGGAAGACAAACCCCCGTCAGGACTTAGGTGGACCGGTTAACACTTTCCACGCTATCCGGTCGAGTATCCCTTACGGCCCCGAGACGTCCAATGCAGAACTTGCGTCGG
GCGTGACTTCGCAAGACCGTGGTCTTCTTTTCG
GTATGTTCCTTCACCTTAGAGTCCTATGCTCCGATGGCTGATCGTTCCTGCAGTCGAATACCAGTCTATCATCGCGAATGGGTTCAG
GTTCCAGCAGATCAACTGGGCGAACAACGCAAA
GTCAGTGTTTACACAGTGTCCCTTTTTGATTACGGCAGTTGCTGATGGCCTCATAGCTTCCCCTTCTCCAAGCCAGTTGTGCCCGGC
ATTGAGCCTATCATCGGTCAAGCATCTCCGCGCACAGTGAGCGGGCTCGACCCCCTCGACCAGACGAAGACTTTCACTGTCCCGCTGTTCGTGATTCCGAAGGGTGGAGAATACTTCTTC
ATGCCGTCTATCTCTGCTCTTACTTCCACTATCGCCATTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCCTTCCGCTGTTTGTTGTGTCGGTCGCTGTATTCATCGGGTCGAGCACCCATGTCTCTGCTGCCAGACTCGGTGCGAGGCAGTCGCGCACAACGCCTCTCCTCACCAGCTTTCCT
GGGCAAGCCCCGCTACCTTCCATGGAGCAACACGCAAATCAAAGGGGCGCTAACATCTTGCCGCTGGATAACATCCAAGGCGATATCTT
GATCGGAATGAAGAAACAGAAAGAACGCTTC
GTCTTCTTCCACGTCAATGACGCGGCCTCTTTCAAGTCGGCGTTGAAGACCTACGTACCTGAGCGCATCACGTCGGCGGCGACTCTGATTTCAGATCCCGCTCAGCAGCCGTTCATCAGG
GAAAACCCCCCC
TACCGGGCTCCAGGCACTCGGAATCAACTCGGAATTACAGACAATATGGGCGACGCACAATTCCCCAATGGTCAGTTCGCGGACGCCGCCGCCCTCGGGGACGATATC
AGTCAATGGGTGGCGCCTTTCACCGGCACCACTGTCCACGGTGTCTTTTTGATTGGTAGCGACCAG
GATGATTTCTTGGATCAGTTCACAGACGATATCTCGTCGGCCTTCGGAGCCTCA
ATCACCCAGGTGCAGGCGCTGAGCGGCTCCGCTCGTCCAGGAGACCAAGCCGGCCACGAGC
ACTTTGGCTTCCTCGACGGCATCTCGCAGCCCGCCGTCACAGGTTGGGAGACGACCGTC
TTCCCCGGACAGGCAGTTGTTCCGCCAGGAATTATCCTCACTGGGCGCGACGGCGACACGGGCACCCGTCCGTCATGGGCTCTCGACGGCAGTTTCATGGCGTTCCAGCACTTCCAGCAA
AAAGTCCCCGAGTTCAACGCCTACACGCTGGCCAACGCTATTCCGGCCAACAGTGCAGGCAATCTCACTCAGCAGGAAGGTGCAGAATTCCTCGGCGCACGCATGTTTGGTCGCTGGAAG
AGTGGCGCGCCAATCGATCTCGCACCAACGGCAGACGACCCTGCGCTCGGCGTTGACCTCCAGAGGAACAATGACTTCGACTACTCGGATACGCTGACGGACCAGATCAAGTGCCCCTTC
GGCGCACACGTGAGGAAGACAAACCCCCGTCAGGACTTAGGTGGACCGGTTAACACTTTCCACGCTATCCGGTCGAGTATCCCTTACGGCCCCGAGACGTCCAATGCAGAACTTGCGTCG
GGCGTGACTTCGCAAGACCGTGGTCTTCTTTTCG
TCGAATACCAGTCTATCATCGCGAATGGGTTCAGGTTCCAGCAGATCAACTGGGCGAACAACGCAAACTTCCCCTTCTCCAAGCCA
GTTGTGCCCGGCATTGAGCCTATCATCGGTCAAGCATCTCCGCGCACAGTGAGCGGGCTCGACCCCCTCGACCAGACGAAGACTTTCACTGTCCCGCTGTTCGTGATTCCGAAGGGTGGA
GAATACTTCTTCATGCCGTCTATCTCTGCTCTTACTTCCACTATCGCCATTTGA

Retrieve as FASTA