Entry information : CputCcP
Entry ID 10233
Creation 2012-01-31 (Christophe Dunand)
Last sequence changes 2012-01-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: CputCcP
Name CputCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coniophoraceae Coniophora
Organism Coniophora puteana    [TaxId: 80637 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CputCcP
start..stop
S start..stop
HpinCcP 569 0 1..365 1..370
SnivCcP01 567 0 26..370 16..366
SlacCcP01 566 0 1..370 1..371
PinvCcP 560 0 5..365 11..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1498073..1498363 291 N° 2 1498420..1498468 49 N° 3 1498525..1498606 82 N° 4 1498922..1499192 271
N° 5 1499244..1499260 17 N° 6 1499310..1499453 144 N° 7 1499506..1499577 72 N° 8 1499632..1499715 84
N° 9 1499766..1499865 100  
join(1498073..1498363,1498420..1498468,1498525..1498606,1498922..1499192,1499244 ..1499260,1499310..1499453,1499506..1499577,1499632..1499715,1499766..1499865)


exon

Literature and cross-references CputCcP
DNA ref. JGI genome:   scaffold_9 (1498073..1499865)
Cluster/Prediction ref. JGI gene:   167018
Protein sequence: CputCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371
PWM (Da):   %s   40524.19  
PI (pH):   %s   8.99
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFALRRFPKTAALRRASAVPKQSTRLPSFRAYSTEGANAKPKSNNAALYGIAAAIAGGGAFYLFSGSDDASTVAKGAVQVAKAGVGFVPSKADYQKVYNRIAEIIDDAGEYDDGSYGPVLLRLAWHASGTYDKETGTGGSNYATMRFEPEALHGANNGLNLARGLMEKVKQEFSWISYGDLWTLGGVVAVQEMGGPKIPWRPGRIDGFAKDATPDGRLPDASQGSSHVRIFYRMGFNDQEIVALVGAHALGRCHTSRSGYEGPWTFSPTTFTNDFYKLLFDETWVWKKWSGPKQLEDKKTKSLMMLPTDYVMVSDKSFKKYAKAYAEDNDLFFKDFSAAFSRLLELGVPTAQFTSSAPWEMGNADEQ

Retrieve as FASTA  
Remarks Complete sequence from genomic (8 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTGCCCTCCGTAGATTCCCCAAGACCGCCGCCCTCAGACGTGCTTCCGCCGTCCCGAAGCAGTCGACGCGTCTCCCATCCTTCCGTGCATACTCTACCGAGGGCGCCAACGCG
AAGCCCAAGTCCAACAACGCCGCTCTTTACGGTATCGCAGCTGCCATCGCAGGCGGTGGTGCCTTTTACCTCTTCTCTGGCTCGGACGATGCGTCCACTGTCGCCAAGGGTGCCGTTCAG
GTCGCTAAGGCTGGGGTTGGTTTTGTGCCCTCCAAGGCTGACTACCAGAAG
GTACGTCCTGTCGACACTCAGCTATCACCAAACATGTTTTAAATCGTACATCACAGGTCTACAACCGGA
TTGCTGAGATCATCGACGATGCTGGTGAATACGACG
GTACGTTTTCCCTGACACGATTCCCGACATGGATGACGAATATTTGCCACCCGCAGACGGCTCCTATGGCCCCGTCCTCCTCCG
TCTCGCATGGCATGCGTCAGGTACCTACGATAAGGAGACCGGTACTGGCGGCAG
GTTCGTTGTTTCATCTCTTCCTATCACCCCACGGTAGCTCATAGTTTCCCTTTCATGGCGGCTACT
CGCTTCCTAAATCTGCTTAACCACATCCTCCTTATCTCTTGATGTTTTGTCCCCTATTTGTAATCCGGTTCATCTGTCGAACGCTGCTGGGCTTTGCACATGTCCGCACATTTTCCGCGC
CACCATCTCGACGATCTATCCATGTTTCTCCCTTTGGCATCTTAATTCCCCCGACTCGGCCGACCTCGCGCTTCGCTTCCATGAACCTTCGCGGATCTTGTGAATCATGCATTCCGTCGC
GACGGACAGCAACTATGCCACGATGCGCTTTGAGCCCGAGGCCCTGCATGGTGCCAACAACGGCCTGAACCTTGCCCGCGGCCTCATGGAGAAGGTCAAGCAGGAGTTCTCCTGGATCAG
CTACGGTGATCTGTGGACGCTCGGTGGTGTCGTCGCTGTCCAGGAGATGGGTGGCCCCAAGATCCCCTGGCGTCCTGGACGCATTGATGGTTTCGCTAAGGATGCTACTCCGGATGGCCG
TCTCCCCGATGCCAGCCAGGGATCTTCTCACGTTCGCAAT
GTAAGTTATCAGGCCCCTTTGCTACCGCTTGCCTTCTGACATGGCACACAGATCTTCTACCGCATGGGGTAAGCCATTCC
ACAACGGTAGACGCAATTATATCTGACCTTGCTGCAGCTTCAATGACCAGGAGATCGTAGCATTGGTTGGCGCTCATGCTCTTGGTCGCTGCCACACCTCTCGCTCCGGTTACGAGGGCC
CTTGGACTTTCTCCCCGACTACGTTCACTAACGACTTCTACAAGCTCCTCTTTGACGAGAC
GTGAGTACCTTTCGAAAGGATGACTCGCTTCAACTCAACTTTGCCGTGTCAGGTGGGTG
TGGAAGAAATGGTCTGGCCCTAAGCAGCTTGAGGATAAGAAGACGAAGAGCCTCATGATGCTTCC
GTACGTTGTTTTCTGCACTGCGAGATTTGCGCGTGTACTGATTGATCCGCTCAGC
ACCGACTACGTGATGGTCTCGGACAAGAGCTTCAAGAAGTACGCCAAGGCTTACGCTGAAGACAACGATTTGTTCTTCAAGGA
GTACGTGCCCTCGACTCTCACCCAGAAGGCGTTTACT
AACTTGTCGACAGCTTCTCGGCCGCCTTCAGCCGTCTGCTTGAGCTCGGCGTACCCACCGCTCAGTTCACCAGCAGTGCCCCATGGGAGATGGGCAATGCCGACGAACAGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTTGCCCTCCGTAGATTCCCCAAGACCGCCGCCCTCAGACGTGCTTCCGCCGTCCCGAAGCAGTCGACGCGTCTCCCATCCTTCCGTGCATACTCTACCGAGGGCGCCAACGCG
AAGCCCAAGTCCAACAACGCCGCTCTTTACGGTATCGCAGCTGCCATCGCAGGCGGTGGTGCCTTTTACCTCTTCTCTGGCTCGGACGATGCGTCCACTGTCGCCAAGGGTGCCGTTCAG
GTCGCTAAGGCTGGGGTTGGTTTTGTGCCCTCCAAGGCTGACTACCAGAAG
GTCTACAACCGGATTGCTGAGATCATCGACGATGCTGGTGAATACGACGACGGCTCCTATGGCCCCGTC
CTCCTCCGTCTCGCATGGCATGCGTCAGGTACCTACGATAAGGAGACCGGTACTGGCGGCAG
CAACTATGCCACGATGCGCTTTGAGCCCGAGGCCCTGCATGGTGCCAACAACGGCCTG
AACCTTGCCCGCGGCCTCATGGAGAAGGTCAAGCAGGAGTTCTCCTGGATCAGCTACGGTGATCTGTGGACGCTCGGTGGTGTCGTCGCTGTCCAGGAGATGGGTGGCCCCAAGATCCCC
TGGCGTCCTGGACGCATTGATGGTTTCGCTAAGGATGCTACTCCGGATGGCCGTCTCCCCGATGCCAGCCAGGGATCTTCTCACGTTCGCAAT
ATCTTCTACCGCATGGGCTTCAATGAC
CAGGAGATCGTAGCATTGGTTGGCGCTCATGCTCTTGGTCGCTGCCACACCTCTCGCTCCGGTTACGAGGGCCCTTGGACTTTCTCCCCGACTACGTTCACTAACGACTTCTACAAGCTC
CTCTTTGACGAGAC
GTGGGTGTGGAAGAAATGGTCTGGCCCTAAGCAGCTTGAGGATAAGAAGACGAAGAGCCTCATGATGCTTCCCACCGACTACGTGATGGTCTCGGACAAGAGCTTC
AAGAAGTACGCCAAGGCTTACGCTGAAGACAACGATTTGTTCTTCAAGGA
CTTCTCGGCCGCCTTCAGCCGTCTGCTTGAGCTCGGCGTACCCACCGCTCAGTTCACCAGCAGTGCCCCA
TGGGAGATGGGCAATGCCGACGAACAGAAG

Retrieve as FASTA