Entry information : EcamAPx-R (EcC049908.20)
Entry ID 10235
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamAPx-R (EcC049908.20)
Name (synonym) EcamAPx-R (EcC049908.20)
Class Ascorbate peroxidase related    [Orthogroup: APx-R001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx-R
start..stop
S start..stop
EglAPx-R 664 0 1..341 1..342
EguAPx-R 659 0 1..341 1..342
EgrAPx-R 650 0 1..341 1..342
CsAPx-R 455 3e-162 7..341 2..335
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..229 229 N° 2 311..392 82 N° 3 1047..1174 128 N° 4 1702..1772 71
N° 5 1955..1997 43 N° 6 2074..2170 97 N° 7 2341..2424 84 N° 8 2934..3055 122
N° 9 3416..3482 67 N° 10 3930..4029 100  
join(1..229,311..392,1047..1174,1702..1772,1955..1997,2074..2170,2341..2424,2934 ..3055,3416..3482,3930..4029)


exon

Literature and cross-references EcamAPx-R (EcC049908.20)
Protein sequence: EcamAPx-R (EcC049908.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341
PWM (Da):   %s   36372.36  
PI (pH):   %s   7.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASPSPSTTHLSPLTCCSSSSLSSHPSSRRTKFEFPANSQRSSPSPIASRAGAIVSPSSSTPGAASSGDHAPVRGRSVAGLAATLPFLLQLRGYTEGIVADAAELDNDEYTMIKEEVRKVVSKMKAAGVLRLVFHDAGTFEMGENGGMNGSIVYELERPENAGLKKPVKILEKAKGEVDAKRVSWADMIAVAGAEAVSVCGGPTIPVVLGRLDSMKPDPEGRLPEETLDALGLKQCFQRKGLSTQELVALSGAHTLGSKGFGNPVVFDNSYYKVLLEKPWMSAGMPSMIGLPSDRALVEDNECLRWIEKYANDQNLFFKDFENAYVKLVNSGARWRS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTCCTCCTCCTCCCTTTCCTCCCATCCCTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCCCAA
CGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGTCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
GTTTCGCGAAT
CTGGTCGATCGCGATCTTTCGGAGCTCGCAGCTGGAGACCGCGTCTCGAGGAGGAGGAGGAAGCTCATAGCCGTGGCGGGCCTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGCGGT
TACACGGAGGGAATCGTCGCCGACGCCGCCGA
GTAAGCTCGACGCTCTTTGCTTGACGAAAGTCCATGTCTTTATTGGTTGGACCGAATGAAACGGGAATTTCGAGGGAGATTGAGATGC
TTTTGAGCTTTGGAGTTGAGCCTGCGGAGCGAAAGAAGGCTTTCCGTTTTCGTCGGTGGTCGGATTATGGGTTTTGCAGCTGCTTCTTCCGGTGATCAGTTTGTGTGTATGTGTGCATGC
TACGGAGTTGTCCCGCCGAAATGACGCTTTTTGCTTCCTTTAAAGGACTTACTTGCCGTTTAAAGTAGAAGGTCCAGGTGTGGTCCTTCGGATTATGAGATTTTAGTTTGTGTTTCCGGC
TGGCATTTGAGGGGTAAAAACGTATCCTGGGATGGGTTTCCTGGTTGCTCATTCACTGACTTCCTGGATTTTAGTATCTGTAAGCTGTAACTGTGAATTGTCTTGTTTCTCAACATTGAT
GTTATGGACACCGTATTCAGCTGGGGAAAAACCATTTTGGGTGATGGTTTGATGGGTCGAAATTGCGATTCGGAAGTACTAATTGGATAGGGCTGTGAGTTTGATATGTTGTTTATCGTG
ACCTTGGGGCTGCATCTGTATTTGTGTTGACTTGGGGCATTTGGATATGTCCATGACTGTTGGTTTTTCATGTTCGTATATCAAAGATTAGATAATGATGAATACACGATGATAAAGGAA
GAGGTCAGAAAGGTAGTTTCCAAAATGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTATTTTACATGGACAGAAAGTTAAA
GTTCTACAAATAATGATACTCGACATCAGTAACTGTGCTCCATATCTCTGGCTACAATTTTTGAATGCCTACTAATCTATCCAAATTGTTTTATCCTCTTTTCCCCATAATTGAACTTTT
GAGCTGAAGCTAAGATGATGCATATATTGATTTCATCTGAATTAGGGGGATATAGCTCTCATTTGCCAAAAAAGTTAGATAATCCCTGTAAATGGGCATAACTTTTTTTGTCATGGTGGT
TTACTAAATGAACAAGGGCAATTAATTCTATGACTGTTAAAGCAACTACAGACTCTAATGGACCTTTATAAATGAATGATCAATCATAGAGAGCAGTATCATTCATACTACCTGTATTTG
TGAACTAATGGTCATGTCCGATTCTTTTATTGCATGCACATACTTCTTTTGAGTTGAAAATTTTCTGCGTCATGCTTTTTTGTCTGAGTATGGATTTCAATCCTCATATTGTAATTCTAA
TATGTTTGTGTCAATATCCAGGTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGGCCTGAAAATGCTGGGCTAAAAAAGCCTGTGAAGGTATGTTTTCTTTTATTACATCCTCAAG
CTTAGCATCCATTCTGGAGATGCAACATTTCATTTCAACTAGTGTACTCCCTCATGCATTTCTGGACTGCTAGAAGTTCCTGTATCTTATGTCTAGAATAGTCAACTCCGGTTCATCTTC
AGGCTAACTCGTCAGTCATTGTGTTGTTGTTTAGATACTAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAGGTGATTTTTTTTAGTGTTATATTCTATATGCTGATGGTATGAT
TGTGGTGATATAGATGGAACTTTCCTCTCTCAGTATCCTGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTTTCTGTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGAC
TTGACTCAAT
GTAAGAAGCTATTTCCAATTCAATTACTACTGTTCTGAAGATGCGTTGATGGCAGACAAAACGTTATTTCACTCATTTCGTATTGTCAGTATTGCAAGATTCTTTGCATG
TCTCCATCTTTGTGCATAGTCCCAAGCTAATATTGGTTTGGTTTCATTTCTTTATTGAAGGAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAAAGCA
GTGTTTTCAGAGGAAGGGCTTATC
GTGAGTTGCTATCCCATGTACATGTTGAATGATGCTTGCAAATTAAATGAAGTATTGTTTATTGGCTATTGCATATTGTTATGCATCTTACTGCTG
ATGGTTAAACTGTTTAATAGATATTTCGCCGGTCAACATAGAATTGGTTGTTTAGTCAACTGTGATACATTATGTTTTGCAATTTCGGGATGATAGATTCAGAGAAAATAACAACCCCCA
AAAAAGCAAGACAGCTATGCTTCCTTCTGTGGCAATAAGCATTCCTTCTTTGTTTTTCCCCTCCATTCCAAAAAAATTATGCCCTCTCTATGAGTTATTATTCTGACAGTATTAGCTGCA
TGATTACAAAAATGAAGCTTTCAAAACAGACTAAGAACATGTTTGATTGTTCCTGCTATGGACTCTGTTTGATTTTTTTTGCTATAGAAATCTGTCCTTTCAGTTTCTTACACTATTCTG
TAGTTTCTTCTCTCAGCAAAAGGAACATATTGATGTTGTCCTCATCCTCTCAGGACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTGGGAATCCGGTT
GTTTTTGACAATTCATACTACAAGGTTCTTCTAGAGAAACCCTGGATGTCTTCAG
GTAGCGAAAAAACATTGATGGTTCTCATGTTCTTCTGTTAGACTTTTTGCCGGACGTAGTTACGT
TGGCCTACTGGTTCTAGTTTGTTGTAGGTAAAGCATTATTTGGCATGAAATTAGTCCTGCCATCAGCTTTCTAACCCAGGAAAAGATTCTATATCTGATACTATGGAGTCATAATTGTGG
TATTGTTTCAATAGTTAGCTCTGATCCAGTGGAAATTTATTTAGTCTGTACTGGGAAAAGGTTATTCTCACTTTTTCTGTTGCAAAAGCGACCTGAGTTTTTCTCATCGGTAATAGTTCT
CACTTAAGCTTTGCTCTTAATTATCCCTTGCTTAATTTCCTTTTTCTCAATGCAGCTGGTATGCCAAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACAATGAATGCTTA
AG
GTTACTGATTTGATATCCCTACTATTTCCTTTTTACTAGGAAGATGGGAACAGTTTAGCCATATCTTTCTGGCCATAGACTATTATGGTGAGATATATATATATCGCTGTCACTGGCA
CTTGTCAACTTTCAGGGATGCACCATTATTGCCACTTTTGATTTTCTTTTTCTCATGATTCTGGATAAAAGTTGCCTTTTGTCTTAATGATCCAGTTAAATCCACATTCCATAAATATGG
GAGCTGCTATATTATCATGGCCTGTTTATGCTTCTGAGAAAGCTATGTAGAATGGAAATGTGCCGACACAACAAACATAAGTAGCCAGTCTGAAGTAATTAGTATCACCTGATTTACTAT
GGATATTTTGCATGAGAATGTTCTGTTTAATGTGATATTTGTTTCTTTTATTTGCTCGATCATGATACCTATATATTTTATATATACAGATGGATTGAGAAATATGCAAATGATCAGAAT
TTGTTCTTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCACCGTCGCCGTCGACGACCCACCTCTCCCCACTCACCTGCTGCTCCTCCTCCTCCCTTTCCTCCCATCCCTCTTCTCGCAGGACGAAATTCGAATTCCCCGCCAATTCCCAA
CGGTCTTCTCCCTCCCCCATCGCCTCTCGCGCCGGAGCCATCGTCTCTCCCTCAAGCTCGACCCCCGGCGCCGCTTCTTCCGGTGACCACGCCCCCGTGCGCGGTCGAT
CCGTGGCGGGC
CTGGCGGCCACATTGCCGTTTCTCCTTCAGCTGCGCGGTTACACGGAGGGAATCGTCGCCGACGCCGCCGA
ATTAGATAATGATGAATACACGATGATAAAGGAAGAGGTCAGAAAGGTA
GTTTCCAAAATGAAGGCTGCTGGTGTGCTTCGTTTGGTATTTCATGATGCTGGAACCTTTGAAATGGGTGAAAACTCAG
GTGGTATGAATGGTTCCATAGTTTATGAACTTGAAAGGCCT
GAAAATGCTGGGCTAAAAAAGCCTGTGAAG
ATACTAGAGAAAGCAAAGGGTGAGGTGGATGCAAAGAGACCAGTATCCTGGGCAGACATGATAGCTGTGGCTGGAGCTGAAGCAGTTTCT
GTTTGTGGAGGTCCAACTATTCCAGTTGTTCTGGGCAGACTTGACTCAAT
GAAGCCTGATCCTGAAGGAAGACTTCCCGAAGAAACTCTTGATGCTTTGGGTTTAAAGCAGTGTTTTCAG
AGGAAGGGCTTATC
GACACAGGAACTTGTTGCATTATCTGGAGCCCATACCCTCGGCAGTAAAGGTTTTGGGAATCCGGTTGTTTTTGACAATTCATACTACAAGGTTCTTCTAGAGAAA
CCCTGGATGTCTTCAG
CTGGTATGCCAAGTATGATTGGACTTCCTTCTGATCGTGCACTTGTTGAGGACAATGAATGCTTAAGATGGATTGAGAAATATGCAAATGATCAGAATTTGTTC
TTCAAAGATTTTGAGAATGCTTATGTCAAGTTAGTGAATTCTGGTGCAAGGTGGAGGAGCTTG

Retrieve as FASTA