Entry information : EcamAPx07 (EcC038189.20)
Entry ID 10239
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status partial
Reviewer Li
Last annotation changes 2013-05-23 (Li)
Peroxidase information: EcamAPx07 (EcC038189.20)
Name (synonym) EcamAPx07 (EcC038189.20)
Class Ascorbate peroxidase     [Orthogroup: APx004]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx07
start..stop
S start..stop
EglAPx07 575 0 20..313 63..356
EgrAPx07 573 0 20..313 63..356
EguAPx07 571 0 20..313 63..356
VvAPx07 525 0 20..313 51..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..178 178 N° 2 273..307 35 N° 3 436..501 66 N° 4 607..647 41
N° 5 1089..1219 131 N° 6 1403..1509 107 N° 7 2056..2193 138 N° 8 2712..2846 135
N° 9 3082..3189 108  
join(1..178,273..307,436..501,607..647,1089..1219,1403..1509,2056..2193,2712..28 46,3082..3189)


exon

Literature and cross-references EcamAPx07 (EcC038189.20)
Protein sequence: EcamAPx07 (EcC038189.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   313
PWM (Da):   %s   34292.45  
PI (pH):   %s   4.96
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LVRRLTFGFVEMTVRSFSVDVDEFLPAVISQELMASSGSFVESARAADLIQRRQRSEFLSNVRGTLFTAIGNPDLIPSLLTLALNDAMTYDKASKSGGPNGSIRFSSEISRPENKGLSAAMNLLEEAKKEIDSYSKGGPISYADLIQYAQSALKATFLASAIRKCGGNEEKGSLLYTAYGSSGWGLFDKQFGRSDTTEPDPEGRVPQWEKASVKEMKDKFSAIGFGPRQLAVMSLFLGPDQTATETLLAADPDVSPWVQKYQRSRETVSETDYEVDLITTLTKLSSLGQQINYEAYTYPVPRVDFSKLKL

Retrieve as FASTA  
Remarks Partial sequence from Kazusa. Incorrect prediction (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGGTTCGCCGTTTGACCTTTGGCTTTGTGGAAATGACGGTCCGTTCTTTTAGCGTGGATGTTGATGAGTTTCTGCCAGCTGTGATCTCGCAGGAACTGATGGCGAGCTCTGGGTCATTC
GTTGAATCGGCTCGTGCTGCTGATTTGATTCAACGCCGGCAGCGTTCCGAGTTTCTTT
GTAAGCCCCCGTTGAAGAGTCGCTTCTTTTTCTATTGCTAGTGCATTGAAATATGAATCTCC
AGAATCAAATTGACTTCCTTCTGTGTCCTCAGCAAATGTCAGGGGCACCCTTTTCACGGCTATAAAGGTGAATTTTTATTTTGCTTTGGCATTTAGGCATATGATTTTGGCTCTCATGAT
TTTGTTACACATATCCTAAAATGCTATACTTTGATATAAATTTATTAATTGATTTCTCTCTTGGACTCATTTCAGGGAAATCCAGATCTCATCCCATCTTTACTGACGTTGGCATTAAAT
GATGCTATGACTTATGACAAG
GTCACACTTACATTTTGCATGTTGAAATTTAATGGGAATAGTTGATCTCACTAAGTATGATTAGGTAATGATTGGGTGCTGATTTATTTTCCCTCAAGC
TTGCAGGCCTCAAAGTCTGGAGGCCCAAATGGATCCATAAGGTTCAGGTACTTGTCACATTAAAACATGTGAATGCTGATGTGAGTTGATGATCATAGCGCAGAGCAGTATTTTCAATTT
GTTGGGTTTAGTGAGCCCCCTAATTTCGATTTTCTGAGGGTTGAACTCTTCACACAACCGGCTCCCTCTCAGAATGATAATCTAGCGAGGTCTTTGTTTCACACAACCGGCTCCCTCTTA
TATGCAGTTCTATATTACTAATTCAATCTTATCCAGAAATCTCCATTTAGAGAATCAAGAAGCTGAGCATCTAGAGTTAATTGAGGAAAATAGAAAGAGAAACTTGATTGCCCCGCAGGA
TGGTTCCCATGTTTCAAGTTCTAATGTGTATCTTCCAGTTTAAAATTTCATGCTTTTGCCGCACATCTTTTATCTCCTAGATGAGACTCACCATGATTTCCAATGTCATGAACTGTTATT
TCTTGAAGCTCAGAGATTAGCAGACCCGAGAATAAGGGCCTTTCAGCTGCCATGAACTTATTGGAGGAAGCTAAGAAGGAAATAGATTCATATTCCAAGGGCGGACCCATATCCTATGCA
GATCTTATACAGTATGCAG
GTTTGTACATGTTACATAGCTAAGTTGCATGTCCCTAGCATAAAATGCTGCTCTTGGTCTGGACTTCTGTTAGTACCTTCTAGAATAACCCCCAAAAGAAG
AAGTATTCACTAGAGCCATTAGACTTGGGGATCTGGCTTTGAATATCTTATGCCATGTATTGAAAGTTCTGCCTCTGAACAGCACAGAGTGCACTCAAGGCTACCTTTCTAGCTTCAGCC
ATTCGCAAATGTGGTGGGAATGAAGAGAAAGGGAGCTTGCTCTACACTGCCTATGGTTCCAGCGGACAG
GTAATTCCTAATTCGTTGTGTGCATGGAATCTTATGCATTTGCCACCAGAT
TTTATAGTGTATAATCAACAACGAAATAGGAATAAAATTTCCTACAACTAGTAATTTAGTATTCATAATGTGTGACCGTCAGGACTTTTAGTCAGTGTATCTTGGGAGGTGAACTAGTTT
AGGTATAGGTATAGATAAGTCTAAAATTTACTTGCAGCCAGTAGTTTCTCGGGGAATATTCAAAAAATGGTTTCATGCTAACAACAGATGAAGGATTTGTTTCAGAATGTATTGCTTCAT
CTGACGATTGCCATAAAATACCGTGTTTATTGACCATTTGTTGTTGCTCACTATTGCTATGTTCATCCAATAGCTTGATTCTTGAATACATGTTCGGAAAAAAAAATGATCCCTATAGTT
TACCAATTTTTCCTTTGAATATATTGGAAATAAACCTATGAATAACATAAGAACTGCCTTGACATATTGTTTCTCAAATAATTCTCATAGTTTTAGTTCTGATTTTCATATTACATATAT
CATCCTGTCATGCAGTGGGGCTTGTTTGACAAACAATTTGGGAGGTCAGACACCACGGAACCAGATCCAGAAGGTAGGGTCCCCCAGTGGGAGAAGGCCAGCGTGAAGGAAATGAAAGAT
AAATTCTCAGCCATTGGGTTTGGTCCTCGGCAG
GTATATTCAGTAGAACATTTACTGCTTATGCAGGAATACTCTGAACTTCCATACATATTGTCCTCTCTATGCACCAAGAATTTCATC
TACAAAATTGCAATGGGAAAACAAGGTTATCTTTTCACCATTTCCAGAAACCAAGAGACATGCGGCTGAACAAGCAGTTTCATGATGTGCACTGCATTCAGATATATTTGATGATTAATT
TCTCTATTATGTTAATCTTCTCTGAATTAGCTAGATTCTGTTCTTAAAGTTCCATACCATATATATTTTTTTTTGGTAAGGTATTTCCATACCATATATTGTTTTCTGCATCTATATATT
TTTGGAAATTTTTTCAAAGCTCAAAATTGGAGAATTGAATGTGGTTTTCTGTGAAATGATCTCTATTTGCAGATTGGTCTTGTAATGAGATTTAAACATTCTCAGCGTTGCTTCCCGTCA
ATCTCGAAAACTGGTAGTCAATGATGGACTGCATAGGAACTAAATCTGCTTTTAACTTCTTGACTGAACAGCTAGCAGTGATGTCTTTGTTTCTGGGTCCTGATCAGACAGCAACAGAGA
CATTATTAGCAGCCGATCCAGATGTGTCTCCATGGGTTCAAAAATACCAAAGAAGCCGAGAGACTGTGTCGGAGACAGATTATGAG
GTTGGTTATACAAAGTTGCTCTTTTCAGAATGTG
AAAGCCTTACTTGATATTTGCCATCATGGTGGTGAAGAATAACCGAAGAAAAACAATATTATGGCCTTCTATGCCCCAAGAAAAAACGGAATCTCTGAATCGTAATCGATTTGTTGGCCA
AAAAGAATAGTTAATGTAAGCGTCTTAGAATCGTTGCATTCGCTTCACTCGGACATTGATCTTAATCCCGTCTTTTTACAGGTCGATTTGATAACTACTCTGACCAAATTAAGCAGCTTG
GGCCAACAAATCAATTACGAAGCGTACACCTACCCGGTTCCAAGGGTTGATTTCAGCAAGCTCAAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGGTTCGCCGTTTGACCTTTGGCTTTGTGGAAATGACGGTCCGTTCTTTTAGCGTGGATGTTGATGAGTTTCTGCCAGCTGTGATCTCGCAGGAACTGATGGCGAGCTCTGGGTCATTC
GTTGAATCGGCTCGTGCTGCTGATTTGATTCAACGCCGGCAGCGTTCCGAGTTTCTTT
CAAATGTCAGGGGCACCCTTTTCACGGCTATAAAGGGAAATCCAGATCTCATCCCATCTTTA
CTGACGTTGGCATTAAATGATGCTATGACTTATGACAAG
GCCTCAAAGTCTGGAGGCCCAAATGGATCCATAAGGTTCAGCTCAGAGATTAGCAGACCCGAGAATAAGGGCCTTTCAGCT
GCCATGAACTTATTGGAGGAAGCTAAGAAGGAAATAGATTCATATTCCAAGGGCGGACCCATATCCTATGCAGATCTTATACAGTATGCAG
CACAGAGTGCACTCAAGGCTACCTTTCTA
GCTTCAGCCATTCGCAAATGTGGTGGGAATGAAGAGAAAGGGAGCTTGCTCTACACTGCCTATGGTTCCAGCGGACAG
TGGGGCTTGTTTGACAAACAATTTGGGAGGTCAGACACCACG
GAACCAGATCCAGAAGGTAGGGTCCCCCAGTGGGAGAAGGCCAGCGTGAAGGAAATGAAAGATAAATTCTCAGCCATTGGGTTTGGTCCTCGGCAG
CTAGCAGTGATGTCTTTGTTTCTG
GGTCCTGATCAGACAGCAACAGAGACATTATTAGCAGCCGATCCAGATGTGTCTCCATGGGTTCAAAAATACCAAAGAAGCCGAGAGACTGTGTCGGAGACAGATTATGAG
GTCGATTTG
ATAACTACTCTGACCAAATTAAGCAGCTTGGGCCAACAAATCAATTACGAAGCGTACACCTACCCGGTTCCAAGGGTTGATTTCAGCAAGCTCAAATTG

Retrieve as FASTA