Entry information : EcamAPx11 (EcS769027.10)
Entry ID 10246
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status partial
Reviewer Li
Last annotation changes 2013-05-23 (Li)
Peroxidase information: EcamAPx11 (EcS769027.10)
Name (synonym) EcamAPx11 (EcS769027.10)
Class Ascorbate peroxidase     [Orthogroup: APx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx11
start..stop
S start..stop
EgrAPx11 491 3e-179 1..244 16..259
EguAPx11 485 7e-177 1..244 16..259
EglAPx11 450 5e-163 1..243 13..255
CroAPx03 390 7e-139 1..232 18..247
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..65 65 N° 2 273..397 125 N° 3 504..553 50 N° 4 1084..1149 66
N° 5 1230..1278 49 N° 6 1428..1516 89 N° 7 1621..1700 80 N° 8 1786..1888 103
N° 9 2050..2154 105  
join(1..65,273..397,504..553,1084..1149,1230..1278,1428..1516,1621..1700,1786..1 888,2050..2154)


exon

Literature and cross-references EcamAPx11 (EcS769027.10)
Protein sequence: EcamAPx11 (EcS769027.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   244
PWM (Da):   %s   26764.62  
PI (pH):   %s   5.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ARRLLRALILSKQCAPIMLRLAWHDAGTYDATTETGGPNGSIRNEAELRHGSNSGLEIAVDLEGVKASCPKISYADLYLAGVVAVEITGGPSVRFVPGRKDSVESPEEGRLPDAVKGEDASHLREVFYRMGLSDKDIVALSGGHTGRAHIDRSGFDGPWTKEPLKFDNSYFVELLKGYSPGLLQLPSDRVLVEDTEFLPYVELYADEEAFFKDYARSHKKLSELGFTPDYMGLMLAKLKL

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. (5' end is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTAAAGATTCTCGTACCCTTTCTCTTCTTTCTTATTATACCTTTCTTTTTGGCGA
AGTAGTGTCTGTTTGAAGGTTGGTGAGTGATGAAACTTGTCGGATTGCGAGCGACCGGGGGCACATACGCGGTGCTTTGTAGTGTTTCGCGTAGATTGCCTGTTTAAGACTTCTCAAATA
ATGTTGGCGCATGATGGTCATGAAATCTGCAGGTGGCATGATGCGGGCACTTATGATGCTACAACAGAGACGGGAGGGCCTAATGGCTCGATACGGAATGAAGCCGAACTGAGACATGGC
TCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
GTGGGCTTCTGCGGCTTAGCACATATAACTTACCACATTCACAAGTTCATTCTACATTTTCTAGGAACGTCTTTCTTCAAATC
TTTCTACTTCTATTTTGTTTCAGAAGGAGTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAGGTTACTGTCTTTTTCATGAATTTTTGCCTTCTTGGTTAAAAGTTAAA
TGATCTTCTCAGTTGGTGACATGATAAAGAAATATGTAAACCAGCACATAGGTCACAGTGTGCTGCACATGGAAAGAAATCTTTGAGACTATTGATGAACCTGTACTGCACAAATTCCAT
AGCCTGATAGTTTCAAACTTTGCTACTCTTATCTGGGTTTGATGTTAGCTACAGAGAAATCTTGCAGATGTGGTTTCTAAGATGTTAAGGGTGTTATCTGACATTCCATGTGAGGAGACT
TACCCATGCTTACTTTGGATGAAGACGTCGTGGCTAGTTATTTTCTGGCTGTGTTGACTATTTTGCTCGCATTAATCATTATATCTCCAGGGACAGTCTCCAGTTGTTTAATAGCTTTGT
GTTGAATTGCTTTTTATGGTAACTGATGAGCAGCTAGAGCAGTCTATGTAAAAATTCAAGTTCAAGAGGCAAGAATTTTCAGATGTTGTGAACTCACAAGTTCAGGCATAATTTGTTTTT
CAGCTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGCCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGTAAAATTGGCAGAAAGAATTCTTGAGGCCTAATGAAACATGCATCATCAC
TTATATCGACCAAGTCATTTCTATATTAGGATTCTGTGGAGTCTCCAGAGGAAGGACGTCTTCCAGATGCTGTTAAAGGTACGTATCACTAAAACTTTAAGTTGAACAATTCTTAAGTGG
TTTGAACTGATGACACCCATATGAAAATGATACCAGCTTGTATATTAGCAGAGAACCTCAGACTTTCCACAATGCTCTTAATGTAGTCCTTGTTCATCTTAATACAGGTGAAGATGCTTC
GCATTTAAGGGAAGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGCCATACTTTG
GTAGATATTTCAGAAGCCCTAAACCGCTTCATACGAGTCCTTCC
CTGCGGTACCAGCAGTTTGTGCATATTCCGATTTCTTCCTTTTCTTCTCTGAATTTTCAGGGAAGGGCACATATAGATAGATCAGGCTTTGATGGACCCTGGACCAAGGAACCCCTTAAG
TTCGATAATTCTTATTTTGT
GTAAGAGATGATCACACTTCGATGCAATTCTCTCTATTCAAACTCTACTTCCATCAGATGAGCTTTCTGCACAATGCTTGCGCAGGGAACTTCTGAAAGG
ATACTCACCAGGACTTCTGCAACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTTCTTCCCTATGTCGAGCTATATGCTGAG
GTACTATCCATCTAAAGGGGGGCTTTGGAACA
TCTTGTCTTTTAAGTCGTGCTGAAAGAGGCAGTACATGTCCCCAATGGAAGTTCATCATTCTTTGTGCTAGTTTCTTCTTTGTGAGAGAGTTTTCTTTATGTTCTTTTTGGTTTCCGAGC
GACATGCAGGATGAGGAAGCCTTCTTTAAAGACTATGCACGGTCACACAAGAAGCTGTCCGAGCTAGGCTTTACTCCGGATTACATGGGCTTAATGCTAGCAAAGCTCAAATTG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCTCGCAGACTCCTCCGTGCCCTCATTTTGAGCAAACAGTGCGCTCCTATCATGCTTCGCTTAGCGTGGCATGATGCGGGCACTTATGATGCTACAACAGAGACGGGAGGGCCTAATGGC
TCGATACGGAATGAAGCCGAACTGAGACATGGCTCGAACAGTGGATTGGAGATTGCTGTTGATTTATGCG
AAGGAGTCAAGGCTAGCTGTCCGAAAATTTCCTATGCAGATCTTTACCAG
CTTGCTGGGGTTGTCGCAGTTGAGATTACAGGCGGCCCCTCCGTCCGCTTTGTCCCCGGAAGAAAGGATTCTGTGGAGTCTCCAGAGGAAGGACGTCTTCCAGATGCTGTTAAAGGTGAA
GATGCTTCGCATTTAAGGGAAGTATTTTATCGGATGGGCCTATCTGACAAGGATATCGTAGCATTATCAGGAGGCCATACTTTG
GGAAGGGCACATATAGATAGATCAGGCTTTGATGGA
CCCTGGACCAAGGAACCCCTTAAGTTCGATAATTCTTATTTTGT
GGAACTTCTGAAAGGATACTCACCAGGACTTCTGCAACTTCCTTCAGATAGGGTTCTAGTGGAGGATACAGAGTTT
CTTCCCTATGTCGAGCTATATGCTGAG
GATGAGGAAGCCTTCTTTAAAGACTATGCACGGTCACACAAGAAGCTGTCCGAGCTAGGCTTTACTCCGGATTACATGGGCTTAATGCTAGCA
AAGCTCAAATTG

Retrieve as FASTA