Entry information : EcamPrx12 (EcC002566.30)
Entry ID 10252
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: EcamPrx12 (EcC002566.30)
Name (synonym) EcamPrx12 (EcC002566.30)
Class Class III peroxidase    [Orthogroup: Prx055]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx12
start..stop
S start..stop
EgrPrx12 677 0 1..330 5..334
EguPrx12 677 0 1..330 5..334
EgrPrx05 669 0 1..330 5..334
EglPrx12 630 0 1..330 5..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..234 234 N° 2 402..587 186 N° 3 747..906 160 N° 4 1183..1592 410
join(1..234,402..587,747..906,1183..1592)


exon

Literature and cross-references EcamPrx12 (EcC002566.30)
Protein sequence: EcamPrx12 (EcC002566.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330
PWM (Da):   %s   36425.35  
PI (pH):   %s   7.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWWQLLISMLALVSSCAARRFQAEATIELPPPLQWQFYQNSCPDAEKYVRDQVEFYWKQDRTLAPKLIRIVYSDCFVKGCDASVLLDGPDSEKKAPQNAAFLGFTLEVIDKIKEVLEQHCPGVVSCADIINLAARDAVVLAGGTSYPVPTGRRDGNSSTAKSVDLPLQAVSWGSVVPYFQEKGLDVQDLTTLLGGHSLGKTGCQFVADRLYNFNKTGKPDPSVDPSFLSQLREQCPPNSTNQVYLNPDSGSSYSLGKTFYSRVLNHQAVLGIDQQIAANNNSYQIAQRYDASFEDFKKMFGRSMTRLGLVKLLPGDQGEVRKNCRVVNA

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa. containing motif YSDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGTGGCAGCTTTTGATATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCTTCCAGGCAGAGGCGACGATCGAGCTGCCGCCACCATTGCAATGGCAGTTCTACCAGAAC
TCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTCGTCAAG
GTCCGT
ACTGTCTGTTTCTTTTCCCCCGCTCTCGAACGATCTTGAAGTTTGCATTGCTTCGATATCGAGTTTCCATTGCCTTTCTAAGCACGTGATATCCTTTCACCTAACGTTTAAACCTCTCGA
ACCGGGCTTTCTAATGTACCACGCTTTTGTGTATGAAACAGGGGTGCGACGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCGTTTCTAGGGTTTA
CGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGTCCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GTATGCAACATGA
TTCGCAGTTTTCCTTTTTGAGCTTGAAAAGAGATCGTTTGGTCTGCACTGATGATAATCAATATGCTGTTAGTTTGAGTTTTTGGAGCGTTCGATGTGGCAAAAGAAAAAAACAGAATTA
CTGATGCGATAATCATGTTGTAATAGGCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCAAAGTCAGTGGACTTACCGTTGCAAGCCGTCTCGT
GGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GTACGATCCGAACCTCCCATGAGAACTGCTTATTTGGCTCCGTTACATTACCTT
TAGATCGTAACCAATCCAGGCAAATCGTTCAGTTCAATGAATCATGACGTCCCTTTTCACTTTCGAGTTTTCTAAATCACTGCCTAGGTGTCATGATACAAAGAATTCTTCTGACAGTGA
TCTCCTCCAAGCGCACAAAATGGCATTGCTCACGTATTATGTTAATCTCTCGATCATAACCAATTCCTCCTAACTTTGCCAAAACAATTTAAATTTTGACAGGGGGGCATTCACTGGGCA
AGACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAATGCCCACCAAACTCAA
CGAACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCAGGCCGTCCTAGGCATCGACCAGCAGATTGCCGCCAACA
ACAACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGGGGATCAGGGGGAGG
TTCGCAAGAATTGCCGAGTCGTGAATGCGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGTGGCAGCTTTTGATATCCATGCTCGCCTTGGTGAGCTCATGCGCGGCACGGCGCTTCCAGGCAGAGGCGACGATCGAGCTGCCGCCACCATTGCAATGGCAGTTCTACCAGAAC
TCGTGCCCCGATGCCGAGAAGTATGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGGACCCTCGCTCCCAAGCTCATCCGAATTGTCTACTCCGACTGCTTCGTCAAG
GGGTGC
GACGCGTCGGTTCTATTGGACGGGCCAGATTCAGAGAAAAAAGCACCGCAAAATGCAGCGTTTCTAGGGTTTACGTTGGAGGTGATTGACAAGATCAAGGAAGTCCTGGAGCAGCATTGT
CCCGGGGTTGTCTCTTGTGCCGACATTATCAACCTCGCTGCTAGAGATGCTGTTGTCTTG
GCGGGAGGGACGTCGTACCCCGTTCCGACCGGGAGGAGGGACGGGAATTCATCCACTGCA
AAGTCAGTGGACTTACCGTTGCAAGCCGTCTCGTGGGGATCGGTGGTCCCTTACTTCCAAGAAAAGGGCTTGGATGTGCAGGACCTCACCACTCTACTTG
GGGGGCATTCACTGGGCAAG
ACCGGCTGCCAATTCGTCGCGGACAGGCTGTACAATTTCAACAAGACCGGCAAGCCAGACCCAAGCGTGGACCCATCCTTTTTGTCCCAATTGAGGGAGCAATGCCCACCAAACTCAACG
AACCAAGTGTACCTTAACCCTGACTCAGGCTCGAGCTACAGCTTGGGCAAGACCTTCTACTCCAGGGTCCTGAACCACCAGGCCGTCCTAGGCATCGACCAGCAGATTGCCGCCAACAAC
AACAGCTACCAGATCGCTCAGAGGTACGATGCCAGTTTCGAGGACTTCAAGAAGATGTTCGGCCGGTCAATGACCCGGCTGGGGCTCGTCAAGCTCCTTCCGGGGGATCAGGGGGAGGTT
CGCAAGAATTGCCGAGTCGTGAATGCGAAA

Retrieve as FASTA