Entry information : EcamPrx132 (EcC032996.20)
Entry ID 10253
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2014-05-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-05-23 (Christophe Dunand)
Peroxidase information: EcamPrx132 (EcC032996.20)
Name (synonym) EcamPrx132 (EcC032996.20)
Class Class III peroxidase    [Orthogroup: Prx018]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx132
start..stop
S start..stop
EgrPrx132 635 0 19..333 15..329
EguPrx132 623 0 19..333 1..315
EglPrx132 527 0 19..333 15..329
PpePrx27 523 0 8..325 3..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..216 216 N° 2 320..511 192 N° 3 1105..1698 594  
join(1..216,320..511,1105..1698)


exon

Literature and cross-references EcamPrx132 (EcC032996.20)
DNA ref. Ecam genome:   EcC032996 (4014..2317)
Protein sequence: EcamPrx132 (EcC032996.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (309)
PWM (Da):   %s   36532.19 (33761.6)  
PI (pH):   %s   4.63 (4.67) Peptide Signal:   %s   cut: 25 range:25-333
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPDLSVPFFLLLLLLLLRQTAMAVALQPGYYAETCPGAEAVVREAMKVALIREPRSVASVMRFQFHDCFVNGCDGSLLLDDTPTMVGEKEALSNINSLRSFEVIDEAKDALEKACPGVVSCADVIIMAARDAVALTGGPDWEVKLGRMDSLTASQEDSNNIMPSPRANASFLIDLFAGYGLSVKDLVALSGSHSIGQARCFSIMFRLYNQSGTGRPDPAIDPGFLDELYKLCPKGVDQNVTGNLDSTPRVFDNQYFKDLVAGRGFLNSDQTLFTFPQTRAYVRRFSRDQDEFFRAFLEGMIKMGDLVSDQPGEIRRNCRVVNSRPVDGSSES*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCCTGACCTGTCTGTTCCCTTCTTCCTCCTCCTCCTCCTCCTTCTCCTCCGGCAGACGGCCATGGCCGTGGCTCTCCAGCCCGGCTACTACGCCGAGACGTGCCCGGGAGCCGAG
GCCGTGGTGAGGGAAGCGATGAAGGTGGCCCTGATCAGGGAGCCCCGGAGCGTCGCCTCCGTCATGCGCTTCCAGTTCCATGACTGCTTCGTCAAT
GTAAACCGTCGAGCCGTGAATCTT
TTCTGCTTCCGAATCATCTAATTTTCTTCTCCGTTGAATGTGAATGGTTTTCGTTCTTTTGGTTTTCTCTTCCCGAAAGGGCTGCGACGGGTCTCTGCTCCTGGACGACACGCCCACCAT
GGTCGGAGAGAAAGAGGCCCTGTCCAACATCAATTCGCTGCGGTCGTTCGAAGTCATCGACGAGGCCAAGGACGCGCTGGAGAAGGCCTGCCCCGGCGTCGTCTCCTGCGCCGACGTCAT
CATCATGGCTGCTCGGGACGCAGTCGCCCTG
GTGAGTAAAATCTCTTCATCTTTTTACCAACGAACAGAGCACGTCAAGAAATTACACTAAACATCATTCCAAATTGAATTTACTTTGGA
AAACCAGATTTATGTGGACACAAAGAAGAAGAGCTGTCCTTTTAATTACTGTAGACAATGCAATGGCAATTTATGAAAATTTATGAAGTGAGATGAAAGGGAAATGACATTGGAGATATT
GAATTATTTGTTCTTTTGATTCGATGAATATATTCTGAGATGGGGTCGGCGGTTCGTAAATAGGACATGCAAAAAGACAGTATTTTTTTTCCATAAATGGTGAAACTGCAGAATAATAGA
TATTTTGGAGCCTAGACGGTTTTGGCTGCCGGATTTGGCAAATGGTCCCTTCTTCTAGTCCGGGTCCTGGTTCCTGAACAGGCTCGTGGGTGCGGGCCGCTCTGTTTCCGGCCCTGCGAA
TGCGAAAGACGATTGATTTTGCCCGATTTTAGTCCCTAAGGTAGGACCGGGGGAAACAGGGGACATTTACAGCGGTGATCTTAGCCTAAGAACGGACGATCAACTTTGATTTGAGTTCTA
ATGCAACGGAACTATCTTTTCTAGACTGGCGGGCCGGATTGGGAAGTGAAGTTGGGGAGGATGGACAGCCTGACGGCCAGCCAGGAGGACTCGAACAACATAATGCCGAGCCCGAGGGCC
AACGCGAGCTTCCTTATCGATCTCTTCGCCGGCTATGGCCTCTCCGTCAAGGACCTGGTGGCCCTCTCCGGGTCTCACTCCATCGGGCAGGCCCGGTGCTTCTCGATCATGTTCCGGCTC
TACAATCAGTCAGGGACCGGCAGACCGGACCCCGCGATCGACCCAGGTTTCCTGGACGAGCTCTACAAGCTCTGCCCGAAGGGAGTCGATCAGAACGTGACGGGGAATCTGGACTCCACG
CCCCGGGTGTTCGACAACCAGTACTTCAAGGACCTGGTCGCAGGCAGAGGGTTCCTGAATTCGGACCAGACGTTGTTCACATTCCCGCAGACAAGGGCGTACGTGAGGAGGTTCAGCCGA
GACCAGGACGAGTTCTTCAGGGCTTTCCTCGAGGGGATGATCAAGATGGGGGATCTGGTGTCGGACCAGCCCGGCGAGATCAGGAGGAACTGTAGGGTGGTGAACAGCCGGCCGGTGGAT
GGTTCGTCGGAATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCCCTGACCTGTCTGTTCCCTTCTTCCTCCTCCTCCTCCTCCTTCTCCTCCGGCAGACGGCCATGGCCGTGGCTCTCCAGCCCGGCTACTACGCCGAGACGTGCCCGGGAGCCGAG
GCCGTGGTGAGGGAAGCGATGAAGGTGGCCCTGATCAGGGAGCCCCGGAGCGTCGCCTCCGTCATGCGCTTCCAGTTCCATGACTGCTTCGTCAAT
GGCTGCGACGGGTCTCTGCTCCTG
GACGACACGCCCACCATGGTCGGAGAGAAAGAGGCCCTGTCCAACATCAATTCGCTGCGGTCGTTCGAAGTCATCGACGAGGCCAAGGACGCGCTGGAGAAGGCCTGCCCCGGCGTCGTC
TCCTGCGCCGACGTCATCATCATGGCTGCTCGGGACGCAGTCGCCCTG
ACTGGCGGGCCGGATTGGGAAGTGAAGTTGGGGAGGATGGACAGCCTGACGGCCAGCCAGGAGGACTCGAAC
AACATAATGCCGAGCCCGAGGGCCAACGCGAGCTTCCTTATCGATCTCTTCGCCGGCTATGGCCTCTCCGTCAAGGACCTGGTGGCCCTCTCCGGGTCTCACTCCATCGGGCAGGCCCGG
TGCTTCTCGATCATGTTCCGGCTCTACAATCAGTCAGGGACCGGCAGACCGGACCCCGCGATCGACCCAGGTTTCCTGGACGAGCTCTACAAGCTCTGCCCGAAGGGAGTCGATCAGAAC
GTGACGGGGAATCTGGACTCCACGCCCCGGGTGTTCGACAACCAGTACTTCAAGGACCTGGTCGCAGGCAGAGGGTTCCTGAATTCGGACCAGACGTTGTTCACATTCCCGCAGACAAGG
GCGTACGTGAGGAGGTTCAGCCGAGACCAGGACGAGTTCTTCAGGGCTTTCCTCGAGGGGATGATCAAGATGGGGGATCTGGTGTCGGACCAGCCCGGCGAGATCAGGAGGAACTGTAGG
GTGGTGAACAGCCGGCCGGTGGATGGTTCGTCGGAATCTTGA

Retrieve as FASTA