Entry information : EcamPrx130 (EcC033544.20)
Entry ID 10254
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx130 (EcC033544.20)
Name (synonym) EcamPrx130 (EcC033544.20)
Class Class III peroxidase    [Orthogroup: Prx067]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx130
start..stop
S start..stop
EcamPrx129-2 659 0 1..323 1..323
EglPrx130 655 0 1..323 1..323
EgrPrx130 655 0 1..323 1..323
EgrPrx129 650 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..67 67 N° 2 183..325 143 N° 3 1169..1927 759  
join(1..67,183..325,1169..1927)


exon

Literature and cross-references EcamPrx130 (EcC033544.20)
Protein sequence: EcamPrx130 (EcC033544.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   34645.62 (32392.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.92 (9.06) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAYLSFVLVICLISPAISGPLKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGAFFDAAQLKANFAKKGLSLRDMVTLSGAHSTGDSHCSQFTKRLYSFNLTYSQDPSLNPNYAHLLKTKCPRNGPTDPTVPFDPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRMGLIEVLTGTQGEIRKNCRVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCCGCAATTTCAGGTCCGATTTCATTTTCCCTTATGCTAGCAGTTTCAACACGTGCGTTTGAGTTG
ATATATTGTTCATTTTCTTGTCTTGGTCATAACCTTTTGTTTTCGGTTGGGTCCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATGGTGAG
AGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGG
GTAATTTTCTAACTCAAGCATTTTATGTGCAACAT
CATTACAGGTGTGTTTGGTTTAGCAATTGCAAAACTTCTTGGGCAAATGCAAATACTGTTTGGCAAAATTTTTTGGGCACTTTGAGGAGATGCAATTTGCACCTTCAAAGATCTTTAAAG
GCATTTAACACAAATTACGTTTGGAGATACTTTAAAATGTTATGTTTCCAAAATGCTAATAGACATTTTTCCTTCCAACTTTACCATCGCTCAACTTTCATAATTCCGGAAATGTTCTTG
AAAGCCCTAGTTTTGCCTCAGCCACCAACGAGCAACCGGCATACCATCGGTGAGTAGTTGGTGAGCCACTACCACTCTCAATGGTGGTGATTGAGTTCCACCAACAAATAATTTGAGATT
TTTAATAAAAAAATTGGCAAAAACCATTTACAAAATATAATTTGTACCATAGTGTATTTCTATTAAAATTTCTTTTCAACGTGTTTTTAAAATACACTTTACCGAACAGTACTTGTATTT
TGAAAAATCCTTTTAATCCAAAGGTGTTTGCATTTTCCCAAAAATCATTTATGAAAAGTCGAACTAAACACACCTTTTAAGTTTTCTCTTGCAATGTCTATTATATTTGCATATTGATCC
ACTTTTTTTCCCAAAACCCATACATGGGCCAGCTTTCATTTGAATAACTAATCCTAGGAACTTAGAAGTGGGGTTTGCATGATTGATGTCACAAACTCTAAATGGATATCTAAATAAATC
TGTCATAGATTTTACTATATCTAATTATAAATAGTCATGTAAAAAATGGATATTTCTATGGTGTGACGTACGGTCTTCTAGTACTCAGGGTTGCGACGGGTCCATTCTTCTCAACTCGAC
CAAAGGAAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCCGA
CATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTCCC
CGGCGCATTTTTTGACGCTGCGCAACTCAAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCACAGGGGACTCTCATTGCTCCCAATT
CACGAAGCGACTCTACTCCTTCAACTTGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCACGAAACGGCCCCACCGACCCGACCGTACC
ATTTGACCCCGTGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGCCATTGACAAGGGGGTTAGT
GAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTTACGGCCGCGATGGTGCGCATGGGTTTGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGAATTGCAGGGT
GATAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCCGCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCCATG
GTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGG
GGTTGCGACGGGTCCATTCTTCTCAACTCG
ACCAAAGGAAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCC
GACATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTC
CCCGGCGCATTTTTTGACGCTGCGCAACTCAAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCACAGGGGACTCTCATTGCTCCCAA
TTCACGAAGCGACTCTACTCCTTCAACTTGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCACGAAACGGCCCCACCGACCCGACCGTA
CCATTTGACCCCGTGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGCCATTGACAAGGGGGTTA
GTGAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTTACGGCCGCGATGGTGCGCATGGGTTTGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGAATTGCAGG
GTGATAAAT

Retrieve as FASTA