Entry information : EcamPrx26 (EcC035816.20)
Entry ID 10259
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-11 (Qiang Li)
Peroxidase information: EcamPrx26 (EcC035816.20)
Name (synonym) EcamPrx26 (EcC035816.20)
Class Class III peroxidase    [Orthogroup: Prx159]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx26
start..stop
S start..stop
EgrPrx26 667 0 1..325 1..325
EglPrx26 665 0 1..325 1..325
EguPrx26 660 0 1..325 1..325
EgrPrx39 480 1e-172 11..325 11..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..228 228 N° 2 367..561 195 N° 3 680..1231 552  
join(1..228,367..561,680..1231)


exon

Literature and cross-references EcamPrx26 (EcC035816.20)
Protein sequence: EcamPrx26 (EcC035816.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (302)
PWM (Da):   %s   35543.13 (33139.8)  
PI (pH):   %s   9.25 (9.07) Peptide Signal:   %s   cut: 24 range:24-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESKGGNRFLAVLLLSITTTALSFPNHHTGLTPYYYNYACPQALPTIRQVVKAAVKKERRMGASLLRLHFHDCFVNGCDASVLLDPTPTIDTEKLAGANNNSARGFEVIDQIKEEVDKVCGRAVVSCADILAVAARDSVVLLGGPWWNVRLGRRDSTTASRTTANTDLPAPFMDLGALTSSFQKQGLDAKDLVVLSGGHTLGFAQCFTFKDRAHNDSDIHPKFAKKLQSICPRAQSESDSNLAKLDPTSTRFDTLYYNNLLKQKGLLRSDQALFGSGNTDELVRTYSNDATAFWKDFAKSMVKMGNIKPLTGNLGQVRNNCRRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCGAAAGGCGGGAATCGTTTTCTCGCAGTTCTCTTGTTGAGCATCACGACCACAGCTCTCTCTTTTCCTAATCACCACACTGGCCTCACACCTTACTACTACAACTACGCTTGT
CCTCAAGCTTTGCCGACCATCAGGCAAGTCGTCAAGGCAGCGGTGAAGAAAGAGAGACGCATGGGTGCTTCGTTACTGCGTCTGCACTTCCATGACTGCTTCGTTAAT
GTACGACACATT
GCTTGTCTCTTGAAGTACTTACGTAGCTGTAACCGATCACGAAATAAGTTTTGTTTTTTCTTTTTTGGGGCACGGGGGGTGGGGTTTATGTCTGTTGAATTAACATTGCTCTGACTGACC
GTGCAGGGCTGTGATGCTTCGGTACTTCTAGATCCGACGCCCACCATCGATACCGAAAAGCTCGCCGGCGCAAACAACAATTCTGCTAGAGGTTTCGAAGTGATCGATCAGATCAAGGAG
GAGGTCGACAAAGTCTGTGGCCGTGCGGTGGTCTCTTGCGCAGATATTTTGGCAGTTGCTGCTCGTGACTCCGTCGTTTTG
GTAAGTGGTTGCGCTTGCGTTGAATTTTTAAGTCAATAC
GTGTAACTAATCAATGTAATAGCACATATTTAAACAGTGAACTGTTGATGATTTCGATTCTTGGTATTTGGTAATGTAGCTGGGAGGGCCATGGTGGAACGTAAGGCTTGGAAGAAGAGA
CTCGACCACCGCGAGCAGGACGACCGCCAACACGGACCTGCCGGCCCCGTTCATGGATTTAGGCGCACTAACTAGCTCGTTCCAAAAACAAGGCCTAGACGCCAAAGACCTGGTCGTTCT
CTCTGGGGGACACACGCTTGGGTTCGCACAATGCTTTACCTTCAAGGATCGGGCCCATAACGACTCGGACATCCACCCTAAATTCGCAAAGAAGCTCCAATCCATTTGCCCACGCGCCCA
ATCCGAAAGCGACTCGAACCTCGCTAAGTTGGACCCGACGTCGACGCGCTTCGACACGTTGTACTACAATAACTTGTTGAAGCAAAAGGGTCTCCTTCGATCAGATCAAGCACTCTTCGG
TAGTGGCAACACCGATGAGTTAGTGAGGACGTACAGCAACGACGCCACTGCATTTTGGAAAGATTTCGCGAAATCGATGGTCAAGATGGGGAATATAAAGCCGTTAACCGGAAATCTTGG
TCAGGTTCGCAATAATTGTAGAAGGGTGAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAATCGAAAGGCGGGAATCGTTTTCTCGCAGTTCTCTTGTTGAGCATCACGACCACAGCTCTCTCTTTTCCTAATCACCACACTGGCCTCACACCTTACTACTACAACTACGCTTGT
CCTCAAGCTTTGCCGACCATCAGGCAAGTCGTCAAGGCAGCGGTGAAGAAAGAGAGACGCATGGGTGCTTCGTTACTGCGTCTGCACTTCCATGACTGCTTCGTTAAT
GGCTGTGATGCT
TCGGTACTTCTAGATCCGACGCCCACCATCGATACCGAAAAGCTCGCCGGCGCAAACAACAATTCTGCTAGAGGTTTCGAAGTGATCGATCAGATCAAGGAGGAGGTCGACAAAGTCTGT
GGCCGTGCGGTGGTCTCTTGCGCAGATATTTTGGCAGTTGCTGCTCGTGACTCCGTCGTTTTG
CTGGGAGGGCCATGGTGGAACGTAAGGCTTGGAAGAAGAGACTCGACCACCGCGAGC
AGGACGACCGCCAACACGGACCTGCCGGCCCCGTTCATGGATTTAGGCGCACTAACTAGCTCGTTCCAAAAACAAGGCCTAGACGCCAAAGACCTGGTCGTTCTCTCTGGGGGACACACG
CTTGGGTTCGCACAATGCTTTACCTTCAAGGATCGGGCCCATAACGACTCGGACATCCACCCTAAATTCGCAAAGAAGCTCCAATCCATTTGCCCACGCGCCCAATCCGAAAGCGACTCG
AACCTCGCTAAGTTGGACCCGACGTCGACGCGCTTCGACACGTTGTACTACAATAACTTGTTGAAGCAAAAGGGTCTCCTTCGATCAGATCAAGCACTCTTCGGTAGTGGCAACACCGAT
GAGTTAGTGAGGACGTACAGCAACGACGCCACTGCATTTTGGAAAGATTTCGCGAAATCGATGGTCAAGATGGGGAATATAAAGCCGTTAACCGGAAATCTTGGTCAGGTTCGCAATAAT
TGTAGAAGGGTGAAT

Retrieve as FASTA