Entry information : OsPrx16
Entry ID 1026
Creation 2005-08-11 (Filippo Passardi)
Last sequence changes 2005-08-11 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx16
Name OsPrx16
Class Class III peroxidase    [Orthogroup: Prx210]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Roots
Shoots
Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx16
start..stop
S start..stop
SiPrx03 522 0 3..349 1..353
BdiPrx67 513 0 1..351 4..355
ZmPrx143 492 3e-176 18..344 24..354
SbPrx63 458 9e-163 18..326 22..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12561109..12561321 213 N° 2 12564041..12564883 843  
join(12561109..12561321,12564041..12564883)


exon

Literature and cross-references OsPrx16
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q9AS12
DNA ref. GenBank:   NC_008394.1 (12561109..12564880)
Protein sequence: OsPrx16
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351
PWM (Da):   %s   37099.66 Transmb domain:   %s   i7-26o
PI (pH):   %s   6.04
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAMKCLFLFFAFLVAFFPGAAVGAGLKVGFYNKTCPSAERLVQQAVAAAFKNNSGVAPGLIRLHFHDCFVRGCDASVLIDGNDTEKTAPPNNPSLRGFEVIDAAKAAVEAACPRVVSCADILAFAARDSVALTGNVTYKVPAGRRDGNVSIAQDALDNLPPPTFNATELVGRFANKSLTAEDMVVLSGAHTIGVSHCDSFTSRLYNFTGVGDADPAISAAYAFLLRAVCPSNSSQFFPNTTVDMDVITPAALDNKYYVGVANNLGLFTSDHALLTNATLRASVDEFVKSETRWKSKFVKAMVKMGGIEVKTGTTQGEVRLNCRVVNKRSANAELELELAAAMDDGDEVAAS*

Retrieve as FASTA  
Remarks chromosome 1. 16 ESTs (ubiquitous). Rice blast fungus interaction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGAAGTGCCTCTTCCTCTTCTTCGCCTTCCTCGTCGCCTTCTTCCCCGGCGCCGCCGTCGGCGCCGGGCTGAAGGTCGGGTTCTACAACAAGACGTGCCCGTCGGCGGAGCGC
CTGGTGCAGCAGGCGGTGGCCGCCGCGTTCAAGAACAACAGCGGCGTCGCCCCCGGCCTCATCCGCCTGCACTTCCATGACTGCTTTGTCAGA
GTACGTGTTCATCCAGATCATGATCTT
AATTTAGTTTTGCTTATACCTGCACTGTTTTTGTGCAAGAACAGTGGTTAATTGATTTGTTTTTTTCTTTGTACAAAAACGATAAAAACTTTCTTTTTGAAACGTTATAACAGAAATAGA
AGGTGTCAATTTTTCAGATTATACACTTGGGAGAGTTAGCTGGGATATATTTTATGACTAAATGTTGTAAAAGATCGGCATATCACTGTTTAAAAATCAGATCACTGTAGTTCGCAAAAT
CATGTTGCTCTATAATGTGTGCTGCAGTCAAACTATGGTTGTTAACGTTTTTAATTTTTTTCGCGCAAAAAAGAATATAGCAATTAATTTGGTTCCTCAAAAAAGATATATTAATTTGGA
CCACATAGATTGTCTAAAATACGTGTGGTTTGGATTATGGAGAAGACCACATATATTTTGTAATTTTAATTATAACAGTTTTTGGATTATGATAGTATATATAAAATTCAGTTCGACAGT
AGTAGCATTTCTGTTGACTTGGAAAAGTCACAGACGACTCCATTTACCAGAGATAGTACTGTCCCAATGCTAGGTTACTTCACTTTTTGACTTTTGCGCTCTTCACAAATGATTTTGATC
ACTTTTTGTAATTTACATCAAAGTATAATAATAGAATTATAACACTGTGGAAGTATTTATAACAAAAAAAACAATGAAATATTTTCTTCAGAAGACATATATAGAGTTCCAAACGTATTA
GTGGCCAAATTTTAAAACAAAAGTTGATACCGTTGATTCTTAATTGTGGCTAATAATGATAAATTAAGAACTTGGGAAGTGTGTCTGGGATAATCCATGGATTATGGAAAAAAAAAAGAA
CACGTCCTTCATACCATGGGATGCCCCAACCAAAAATGATAGAGCTTATATATAGTTTGAAAATTGAAACATTGGAAACTTATTTCTAATATAATATGTCTCTTTCAGCAAAGGTAGAAC
AATAGCATATTGAAAAGGGCATGCCATCAATATATCGTCACTTTCAGTTAACTGCAATCTGCATACAAATTAATCACATGCATCTAGTTCTTTTTATACCTGCATAATTGACTAGATCGT
GCCGACAACTTAAGAAGAAAAAGAGCTCTCAAGAAGTAGATTTTTTTTTTCGAGTACAAGTCTTACGCGTGCATCTGACTACATGGGAGGCCTAACCTCACGTAAGAGTAAATTTAAGAA
GATTATCCGTGCTAAATTTACGACTTAAATAGGATGATCCACCGCCATATGACGATAATAAACCTAATCAACTCTCATTCGTCTCAAGAGGTTGACTAATTTTACCCCTCATCTCTCCTA
ACTTATACTACAGGCATCTATAACTCTCAATATTTTTCAGGGACCGAATTAAGAAAAAGTCATCTTAGACAGAAGCACTTTTATTATATACTGTCTTGATCCGGCCGGCCTTCTCTCCCA
AACTTCGTTTTTTAGACTCATCTCCCAAACTGTCGACAAACAAATCAAATTTGGCATTGGGGCGTCCGTGTACACACACTACACATGTTCCGCTGAATCTTGATTAGTACAATTAATTAC
ACTGGTTACTTGATGGCTACATTTTTAGCATCAGGGTACGGTCATGAAAACAGGCTGAGCAGATGGCAACGTGCCAACATCAACCAGTTTGTTTTTTTTAAGAAAAAAGAGTCACGTAAA
TAGGTTCTTAGCAGATACACTCCTAGCAACGTGACAAACACATTAGATACACTCCTATGATTCGGCGCCAATAACACTAGCGCTGACCCCCTCTCCCTTGGCACCCCTGCAATGCTGGCA
GCGAAAATTTCAGACTAGAAATACCTACGTTTCTTGGGATGAAATGTTATATGGGAAAACATGGGGAAAAAAGATGCCATAGAGCTCTTAATCCACTACTATATAACGGCATAATTTAAC
CATAGAGAACCCGATGATTTATAATAATGTGCCTAGGAACTAAAGGGTCATTAATTACTTTAATTTGTTCAATGGGATATATATGGGAAGTTGTCATAGCACTAAAATCGTTCAAACGTC
GTTATTCTAAACGAGACAAAATTAACCAGTTGCTCTCATCCCACCCCGGCCCGGCGGCCCCTCTCATCTCACTTGGTTCCTTTTCTCTCCAGCCACCCACGCTGTACCCATTATATACAC
GTCATCTTCCTACACCTCACTTGGCCTTGGTCCATCCCTTCCATTGTGATCTCTTTTCCCATCACGTCTCACCCTTTGCGTCCCCCCTAAATCGCACCCACTCGCCCTTCCTCCTTTGCT
CATCCCGACTCGTAGGGGTGGGCTTGGAATTTGAGATTGTGTATTTAAAAATGTGAAGGGGTAGAAAAAAATTGATTTAAGCTAATGAAATCTAAGCTATGCCAAAAGAAATAAGAAATA
TAGAAGCATATATCAACTGTAAGAGAATTCTGAAGTGCCAATGAATAAATAAGTTCATCCGTTTCTACAACTGGGAGAAATTTAAACTGTGGTAAAGAGTTCAAGGACCGAGATAATTTC
TCAAGGAAATGGTAAAGAGAAACATGAAAAATAAAGATCGTGGACTTTAATGTCGATTTTTCAAATTTATAAATCTAAGTGATACCTCGCTCCAACTTTAATGACCGGCCGTGTAGTTTA
CTCACTAAAAAAACGAAAGGAGAGAATTCTCAATTTTGCTCAATGTCTGCAGGGCTGCGACGCCTCGGTTTTGATCGACGGGAACGACACCGAGAAGACCGCGCCACCAAACAACCCCAG
CCTCCGCGGATTCGAGGTGATCGACGCCGCCAAGGCCGCCGTCGAGGCGGCGTGCCCGCGTGTCGTCTCCTGCGCCGACATCCTCGCCTTCGCCGCCCGCGACAGCGTCGCCCTCACCGG
CAACGTCACTTACAAGGTCCCCGCCGGCCGCCGCGACGGCAACGTCTCCATCGCCCAGGACGCGCTCGACAACCTGCCCCCTCCCACCTTCAACGCCACGGAGCTCGTCGGCCGCTTCGC
CAACAAGTCGCTCACCGCGGAGGACATGGTGGTGCTCTCCGGCGCCCACACCATCGGCGTCTCCCACTGCGACTCCTTCACCAGCCGCCTCTACAACTTCACCGGCGTCGGCGACGCCGA
CCCGGCGATCAGCGCCGCCTACGCGTTCCTCCTCCGCGCCGTGTGCCCCTCCAACAGCAGCCAGTTCTTCCCCAACACCACGGTGGACATGGACGTGATCACCCCGGCGGCGCTCGACAA
CAAGTACTACGTCGGGGTCGCCAACAACCTGGGCCTCTTCACGTCGGACCACGCGCTGCTCACCAACGCCACGCTCAGGGCGTCGGTGGACGAGTTCGTCAAGAGCGAGACGCGGTGGAA
GAGCAAGTTCGTGAAGGCCATGGTGAAGATGGGCGGCATCGAGGTGAAGACCGGGACGACGCAGGGCGAGGTCAGGCTCAACTGCAGGGTCGTCAACAAGAGGAGCGCCAACGCTGAGCT
CGAGCTCGAGCTCGCCGCCGCCATGGATGATGGGGATGAAGTGGCAGCGAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATGAAGTGCCTCTTCCTCTTCTTCGCCTTCCTCGTCGCCTTCTTCCCCGGCGCCGCCGTCGGCGCCGGGCTGAAGGTCGGGTTCTACAACAAGACGTGCCCGTCGGCGGAGCGC
CTGGTGCAGCAGGCGGTGGCCGCCGCGTTCAAGAACAACAGCGGCGTCGCCCCCGGCCTCATCCGCCTGCACTTCCATGACTGCTTTGTCAGA
GGCTGCGACGCCTCGGTTTTGATCGAC
GGGAACGACACCGAGAAGACCGCGCCACCAAACAACCCCAGCCTCCGCGGATTCGAGGTGATCGACGCCGCCAAGGCCGCCGTCGAGGCGGCGTGCCCGCGTGTCGTCTCCTGCGCCGAC
ATCCTCGCCTTCGCCGCCCGCGACAGCGTCGCCCTCACCGGCAACGTCACTTACAAGGTCCCCGCCGGCCGCCGCGACGGCAACGTCTCCATCGCCCAGGACGCGCTCGACAACCTGCCC
CCTCCCACCTTCAACGCCACGGAGCTCGTCGGCCGCTTCGCCAACAAGTCGCTCACCGCGGAGGACATGGTGGTGCTCTCCGGCGCCCACACCATCGGCGTCTCCCACTGCGACTCCTTC
ACCAGCCGCCTCTACAACTTCACCGGCGTCGGCGACGCCGACCCGGCGATCAGCGCCGCCTACGCGTTCCTCCTCCGCGCCGTGTGCCCCTCCAACAGCAGCCAGTTCTTCCCCAACACC
ACGGTGGACATGGACGTGATCACCCCGGCGGCGCTCGACAACAAGTACTACGTCGGGGTCGCCAACAACCTGGGCCTCTTCACGTCGGACCACGCGCTGCTCACCAACGCCACGCTCAGG
GCGTCGGTGGACGAGTTCGTCAAGAGCGAGACGCGGTGGAAGAGCAAGTTCGTGAAGGCCATGGTGAAGATGGGCGGCATCGAGGTGAAGACCGGGACGACGCAGGGCGAGGTCAGGCTC
AACTGCAGGGTCGTCAACAAGAGGAGCGCCAACGCTGAGCTCGAGCTCGAGCTCGCCGCCGCCATGGATGATGGGGATGAAGTGGCAGCGAGCTAA

Retrieve as FASTA