Entry information : EcamPrx191 (EcC040761.10)
Entry ID 10268
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-02 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx191 (EcC040761.10)
Name (synonym) EcamPrx191 (EcC040761.10)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx191
start..stop
S start..stop
EguPrx191 640 0 1..317 1..317
EglPrx191 637 0 1..317 1..317
EgrPrx191 635 0 1..317 1..317
CroPrx69 514 0 1..317 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..213 213 N° 2 845..1036 192 N° 3 1288..1833 546  
join(1..213,845..1036,1288..1833)


exon

Literature and cross-references EcamPrx191 (EcC040761.10)
Protein sequence: EcamPrx191 (EcC040761.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (293)
PWM (Da):   %s   34095.04 (31608.7) Transmb domain:   %s   i7-26o
PI (pH):   %s   9.19 (9.38) Peptide Signal:   %s   cut: 25 range:25-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNSNFPIVSVIIVSLLVCLTNAQLSPNFYTRTCPNVQGIVRNAMTQAVRREPRMGASILRMFFHDCFVNGCDASVLLDDTATFTGEKTARPNQNSLRGFEVIDTIKSRVEAACNATVSCADIIALAARDGVVQLGGPSWTVPLGRRDARTASLSGANSQIPSPFSSLATLISSFAAQGLNARDMTALSGGHAIGLARCTTFRNRIYNETNIDASFATTRRTNCPASGGDANLAPLDRTPNRFDNNYYQNLVARRGLLHSDQELFNGGSQDALVRTYSNNYRAFASDFAAAMVKMGNISPLTGRNGEIRRNCRVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAATAGCAACTTCCCCATTGTCTCTGTCATTATTGTATCCCTTCTCGTGTGCCTTACGAACGCACAGCTTTCGCCAAACTTCTACACAAGAACATGCCCCAACGTACAAGGC
ATTGTCCGCAATGCGATGACGCAAGCTGTTAGGAGAGAGCCGAGGATGGGTGCTTCAATACTTCGCATGTTCTTCCATGATTGTTTCGTAAAT
GTGCGTAACTAGGATTCTTTTGCGTTC
ATTTCTAATTATTACTTCTTTCAAGAACATTTTTGGTTGCATTTTATTTGCGAAGGTTGAATTAGATTTTCTAGTCATTTAAAATATCCAGGCATGTTGATCTCGTAAAGTTGATTTTTA
GTGTTGAGTATAATGTCACGTCATTTGAATAGGTGAGGTTATAACATGCCCTTTAAATATGCAGGCCCCCTCTTAAGTTGTTGGGTGGACATTTTGACATTTTATAAAATTTAGGTTTAT
ATATATATATTTATACACGTGCCATATAGTGCAGATCCGTATTTTCTAAGAAGATTAGGATTAGGTACTACATTCAAAGAAGCATTGAATTTGCTTGACTCCCATTTGTTAAGTATCCAT
GAAATTGACTTGGATTTTGGAGGGGCAAGAAAAGCACACGATGAGATTATATATCCTTTCTGAACTTATTCTAATAGATGATTTAAACTAATCATCTGATCTAAGAAAACTTCTGCCACA
TGTGCTCAATCCATCACTAATCAAAAGATGAAAAAAAGATGAACTCTTAATTAAGTGATAAGGTGCAAATTGTGACCTTCTCTTTCGAAACAATCTTATCATGTATCTCGGCCTTCTTGT
GTAGGGATGTGACGCATCGGTTCTTTTGGATGACACCGCTACCTTCACCGGAGAAAAGACCGCTCGGCCGAACCAAAACTCTCTTAGGGGATTCGAAGTCATCGACACCATTAAGTCCCG
TGTCGAAGCTGCTTGCAATGCTACCGTTTCTTGCGCAGACATCATTGCGCTCGCTGCTCGAGACGGCGTTGTCCAA
GTGAGTGTCTCATATATCATGATCGTTACTAACTTTTGCTCCTA
TTTTCTCTTTAATGCATGATTTTGGTTTATATTAACTTCAAATCTCTGACCATAGCAATTACATAATAGTCATCCCCTGTTTCATGATTGGATTAGTCCATATTTATGGGATAAATTCCA
ATTTTTTATACATAACATTTTTATAGAAGACTGAACATTTCGCAACATAAATTGTATAAGCTTATGCGATTGATATTGGCATTACAGTTGGGAGGACCATCTTGGACGGTGCCTCTAGGG
CGGCGAGATGCAAGGACCGCTAGCCTGAGCGGTGCCAACAGCCAAATCCCATCGCCTTTCTCCAGCCTCGCCACCCTCATCTCCTCCTTCGCTGCCCAAGGCCTCAATGCCCGTGACATG
ACCGCCCTGTCTGGGGGCCATGCTATTGGCCTGGCCCGGTGTACCACCTTCCGGAACCGCATCTACAATGAGACCAACATCGACGCCAGCTTCGCTACCACCCGAAGGACTAACTGCCCT
GCCTCTGGAGGGGACGCCAACCTTGCTCCCCTCGACCGGACCCCGAACCGGTTTGACAACAACTACTACCAGAACCTCGTGGCACGGCGTGGGCTCCTCCATTCGGATCAAGAGCTGTTC
AATGGAGGATCACAGGACGCACTCGTTAGGACTTACAGCAATAACTATAGGGCTTTCGCGAGTGATTTTGCGGCTGCGATGGTGAAGATGGGTAACATCAGCCCGCTCACCGGAAGAAAT
GGAGAGATCAGAAGGAACTGTAGGGTGGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTCCAATAGCAACTTCCCCATTGTCTCTGTCATTATTGTATCCCTTCTCGTGTGCCTTACGAACGCACAGCTTTCGCCAAACTTCTACACAAGAACATGCCCCAACGTACAAGGC
ATTGTCCGCAATGCGATGACGCAAGCTGTTAGGAGAGAGCCGAGGATGGGTGCTTCAATACTTCGCATGTTCTTCCATGATTGTTTCGTAAAT
GGATGTGACGCATCGGTTCTTTTGGAT
GACACCGCTACCTTCACCGGAGAAAAGACCGCTCGGCCGAACCAAAACTCTCTTAGGGGATTCGAAGTCATCGACACCATTAAGTCCCGTGTCGAAGCTGCTTGCAATGCTACCGTTTCT
TGCGCAGACATCATTGCGCTCGCTGCTCGAGACGGCGTTGTCCAA
TTGGGAGGACCATCTTGGACGGTGCCTCTAGGGCGGCGAGATGCAAGGACCGCTAGCCTGAGCGGTGCCAACAGC
CAAATCCCATCGCCTTTCTCCAGCCTCGCCACCCTCATCTCCTCCTTCGCTGCCCAAGGCCTCAATGCCCGTGACATGACCGCCCTGTCTGGGGGCCATGCTATTGGCCTGGCCCGGTGT
ACCACCTTCCGGAACCGCATCTACAATGAGACCAACATCGACGCCAGCTTCGCTACCACCCGAAGGACTAACTGCCCTGCCTCTGGAGGGGACGCCAACCTTGCTCCCCTCGACCGGACC
CCGAACCGGTTTGACAACAACTACTACCAGAACCTCGTGGCACGGCGTGGGCTCCTCCATTCGGATCAAGAGCTGTTCAATGGAGGATCACAGGACGCACTCGTTAGGACTTACAGCAAT
AACTATAGGGCTTTCGCGAGTGATTTTGCGGCTGCGATGGTGAAGATGGGTAACATCAGCCCGCTCACCGGAAGAAATGGAGAGATCAGAAGGAACTGTAGGGTGGTGAAC

Retrieve as FASTA