Entry information : EcamPrx20 ( EcC045726.10)
Entry ID 10277
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-03-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-23 (Achraf Jemmat)
Peroxidase information: EcamPrx20 ( EcC045726.10)
Name (synonym) EcamPrx20 ( EcC045726.10)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx20
start..stop
S start..stop
EgrPrx20 627 0 1..319 1..319
EgrPrx18 619 0 1..319 1..319
EguPrx17 608 0 1..319 1..319
EgrPrx17 607 0 1..319 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 169..216 48 N° 2 1269..1460 192 N° 3 1581..1746 166 N° 4 1869..2251 383
join(169..216,1269..1460,1581..1746,1869..2251)


exon

Literature and cross-references EcamPrx20 ( EcC045726.10)
Protein sequence: EcamPrx20 ( EcC045726.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319
PWM (Da):   %s   33661.53  
PI (pH):   %s   6.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSTRPAFLLLLCFLHGTASAQLSSTFYSTSCPSALSTIKSSVSSAVENEARMGASLLRLHFHDCFVNGCDASILLDDTTNFTGEKNAGPNANSMRGFEVIDTIKSELESKWPGIVSCADILAVVARDSIVALGGPS*TVSLGRRDSTTASQSAANISIPPPTLNLSGLISAFSNKGFTAKEMVALLGSHTIGQARCLTFREHLYNENNIDATFATSLKANCPSSGGDSNLFPFDTTSPTSFDNAFFKNLQTHKVFLHSDQQLFSGGSTDAHVNAYSSDLSTFRTDFANAMVKMGNISPLIGSSGQIRKNCRKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa (5' end is missing which has been completed manully, A stop in frame maybe due to bad sequencing). Close to EcC029899.30 and EcC029899.30(Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCGTCCTTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAATGCAAGTCCCTCTGCTCTGAGTCTCTCCTCTCTTTCCGATTGATTACTACCTTTGTTTCTCTCCTTCATTCAA
GCTGAATGCAAGCGATTGTGCCTACGCATGTAAAGCGTTCCATCCAACCACATAGTCAAAAGAATCATTAGATTCGCTTCTACGCAAGTCACGTACTCTCTTTTTCACTAACCAGACAGT
AGGTAGGAGGTTGACATATTGAATAAGTTGAGATTTTTGGTGCTTCGTTGTGTCATGAATTTTTGTGAGTTTATTATACTAATAATCAATTCTGTTTATTAGAGCACAATAATTTTTTTG
GTAATTTGAAAAAACTTCATGATTATTTTTAGCATACATTGCCGGTGTAAAAATATTTTTCACAAACAATCTTATCCACCCTTAATTTGGCGGTTAGTGAGAGATTTGGTAATTAGAATC
CTCAAATTACGAATGGCCAAGAATGATTATGTAAAATTTTCTTTACATTGATGGTCTATGCTCTAATTTTCACCGGAAAAAACTATGCAGGAGAGCGTACTTTACGCTAACTATGCTGTT
GATCAGATAAATGGGTATATAAATAACATTGGAGCTGGCAAAAAGAGAGAGATGGCCATTGCTTTTTATATCGGCGGTTGACTTTACTCGGTTATCACATTTGGCTAACCAATCAGTCCT
TTTCTATAGATTTTGATCATATTTTGATCACCTCGCTGTGGTAGCCATATATTTCTACATAAAAAGTGATATGGATGGTAAAGTATCATTTTTAATGAAATTGATAACTCAATACTATTC
TAAAATCGCACTAGATCTTTGAACAATCAAATCGTGCCTTTCGCATGGCCTCATTAGTTTGCTTTCACACAAATTCAAACGTCGATCTAAATTAACTAATCGATTCAGATTAGTATGTTC
ATAATGGGGGGGCAAACTATTTCAGTAAAGATTAGAGCACTTAACTTGTTCGCAACCATTAAATCTAATTAATTCCAATCGGATCAATTTTCTATCTAGAAGGACTGATTAACAACACGT
GGCAAAAAAACATGAAATAGGGATGTGATGCGTCAATCTTATTGGACGACACTACGAACTTTACCGGGGAGAAGAACGCCGGCCCGAATGCCAATTCCATGCGGGGATTTGAGGTAATCG
ACACAATCAAGTCCGAATTGGAGAGCAAGTGGCCCGGTATCGTGTCCTGCGCTGATATCTTAGCCGTCGTTGCACGAGACTCCATCGTTGCC
GTAAGTGCACATTTTCTTCTCAATTCTA
CTTATCAATTGTGATGAAAAAAATCACATGTTATGTTCCCCATGCTATATTAATACTAACACGCATGGATTTGTAATTTATTTAATTTTTAGTTAGGTGGCCCTAGTTGAACAGTCTCCC
TTGGAAGAAGAGACTCAACCACTGCAAGTCAAAGTGCTGCTAATATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTCTGCCTTCTCTAACAAAGGCTTCACAGCTAAAG
AAATGGTGGCACTTTTAG
GTCATTGTTTCTATTTTCTGTTTTTATTTTTTTTTGTTGCATTTTTTAAATAAAGAATAACAATAATGCTCATTCAATATACTAAAATCAATTTACAAAAAT
TGTTTGACCATTGTTAACAGGGTCGCACACAATAGGTCAAGCCCGATGCCTGACTTTCCGGGAGCATCTTTACAATGAGAACAACATCGACGCCACGTTTGCGACATCGCTGAAAGCAAA
TTGCCCGAGCTCCGGAGGCGACAGCAACCTCTTTCCTTTTGACACCACAAGCCCGACGTCCTTTGACAACGCCTTCTTCAAGAACTTGCAAACCCACAAGGTTTTTCTTCATTCGGACCA
GCAATTGTTCAGTGGTGGTTCCACAGACGCTCACGTGAATGCTTATAGTAGCGATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACATTAGCCCACTCAT
TGGCTCAAGCGGTCAGATTAGGAAGAACTGCAGGAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCGTCCTTGCTCCGCCTTCACTTCCACGATTGCTTCGTCAATGGATGTGATGCGTCAATCTTATTGGACGACACTACGAACTTTACCGGGGAGAAGAACGCCGGCCCGAATGCC
AATTCCATGCGGGGATTTGAGGTAATCGACACAATCAAGTCCGAATTGGAGAGCAAGTGGCCCGGTATCGTGTCCTGCGCTGATATCTTAGCCGTCGTTGCACGAGACTCCATCGTTGCC
TTAGGTGGCCCTAGTTGAACAGTCTCCCTTGGAAGAAGAGACTCAACCACTGCAAGTCAAAGTGCTGCTAATATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTCTGCC
TTCTCTAACAAAGGCTTCACAGCTAAAGAAATGGTGGCACTTTTAG
GGTCGCACACAATAGGTCAAGCCCGATGCCTGACTTTCCGGGAGCATCTTTACAATGAGAACAACATCGACGCC
ACGTTTGCGACATCGCTGAAAGCAAATTGCCCGAGCTCCGGAGGCGACAGCAACCTCTTTCCTTTTGACACCACAAGCCCGACGTCCTTTGACAACGCCTTCTTCAAGAACTTGCAAACC
CACAAGGTTTTTCTTCATTCGGACCAGCAATTGTTCAGTGGTGGTTCCACAGACGCTCACGTGAATGCTTATAGTAGCGATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTG
AAGATGGGTAACATTAGCCCACTCATTGGCTCAAGCGGTCAGATTAGGAAGAACTGCAGGAAAGTCAAC

Retrieve as FASTA