Entry information : EcamPrx129-1 (EcC047238.20)
Entry ID 10282
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx129-1 (EcC047238.20)
Name (synonym) EcamPrx129-1 (EcC047238.20)
Class Class III peroxidase    [Orthogroup: Prx066]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx129-1
start..stop
S start..stop
EcamPrx129-2 587 0 1..284 40..323
EgrPrx129 582 0 1..284 40..323
EglPrx130 580 0 1..284 40..323
EgrPrx130 580 0 1..284 40..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..93 93 N° 2 935..1696 762  
join(1..93,935..1696)


exon

Literature and cross-references EcamPrx129-1 (EcC047238.20)
Protein sequence: EcamPrx129-1 (EcC047238.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   284
PWM (Da):   %s   30591.43  
PI (pH):   %s   8.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGAFFDAAQLEANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNSPTDPIVPFDPVTPNVLDNAYYHNLKSDKGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRMGSIEVLTGTQGEIRKNCRVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGGGTAATTTTCTAACTCAAGCATTTTATG
TGCAACATCATTACAAGTGTGTTTGGTTTAGCAATTGCAAAACTTGGGCAAATACAAATACTGTTTGGCAAAATTTTTTGGGCACTTTGAGGAGATGCAATTTGCACCTTCAAAGCTCTT
TAAAGGCATTTAACGCAAATTAAGTTTGGAGATACTTTCAAATGTTATGTTTCCAAAATTCAAATAGACATTTTTCCTTCCAACTTTACCATCGCTCAACTTTCATAATTCCCAAAATGT
TCTTGAAAGCCCTAATTTTTGCCTCAGCCACCAACGAGCAACCGACGTGCCATCGGTGAGTAGTTGGTGAGCCACTACCACTCTCAATGGTGGTGACTGAGTTCCACCGACAAATAATTT
GAGATTTTTTATAAAAAAATTGGCAAAAACCATTTACAAAGTATAATTTGTACCATATAGTATTTCTATTAAAATTTCTTTTCAACGTGTTTTTAAAATACACTTTACCAAACAGTACTT
GTATTTTGAAAAATCCTTTTAACCCAAAGGTTTTTGCATTTTTACAAAAAACATTTCTAAAAAAATCGAACTAAACACACCTTTTAAGTATTCTCTTGCAATGTCTATTATATTTACATA
TTGATCCACTTTTTTCGTAAAACCCATACATGGGCCAGCTTTCATTTGAATAACTAATCCTAGGAACTTAGAAGTGGGGTTTGCATGATTGATGTCACAAGCTCTAAATGGATATCTAAA
TAAATCTGTCATAGATGTTCCTAGGTCTAATTATAAATAATCATGTAAAAAATGGATATTTCTATGGTGTGACGTATGGTCTTCTACTACTCAGGGTTGCGACGGGTCCATTCTTCTCAA
CTCGACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAGTGCCCTAACACCGTCTCATG
TGCCGACATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAA
CCTCCCCGGCGCATTTTTTGATGCTGCGCAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTC
CCAATTCACGAAGCGACTCTACTCCTTCAACTCGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACAGCCCCACCGACCCGAT
TGTACCATTCGACCCCGTTACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGCCATTGACGAGGGG
GTTAGTGAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTCACGGCAGCGATGGTGCGCATGGGTTCGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGAATTG
CAGGGTGATAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGGGGTTGCGACGGGTCCATTCTTCTCAAC
TCGACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAGTGCCCTAACACCGTCTCATGT
GCCGACATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAAC
CTCCCCGGCGCATTTTTTGATGCTGCGCAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCC
CAATTCACGAAGCGACTCTACTCCTTCAACTCGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACAGCCCCACCGACCCGATT
GTACCATTCGACCCCGTTACGCCGAACGTACTCGATAATGCTTACTACCACAACTTAAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGCCATTGACGAGGGGG
TTAGTGAAGGACAATGCGAACCACCCCAGCGCTTGGGCTCGGAGGTTCACGGCAGCGATGGTGCGCATGGGTTCGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGAATTGC
AGGGTGATAAATTAA

Retrieve as FASTA