Entry information : EcamPrx178 (EcC048808.10)
Entry ID 10284
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx178 (EcC048808.10)
Name (synonym) EcamPrx178 (EcC048808.10)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx178
start..stop
S start..stop
EglPrx178 665 0 1..332 1..332
EgrPrx178 665 0 1..332 1..332
EgrPrx138 662 0 1..332 1..332
EguPrx138 659 0 1..332 1..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..408 408 N° 2 595..757 163 N° 3 1160..1584 425  
join(1..408,595..757,1160..1584)


exon

Literature and cross-references EcamPrx178 (EcC048808.10)
Protein sequence: EcamPrx178 (EcC048808.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (304)
PWM (Da):   %s   35406.69 (32380.2)  
PI (pH):   %s   8.42 (8.58) Peptide Signal:   %s   cut: 29 range:29-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGCFFPNKAALFMMLLTVCIAPTLVQGQGTRVGFYSSSCPRAEAIIRSTVQAHFKSDPTVAPGLLRMHFHDCFVQGCDGSILIDGTNAEKMAGPNRLLRGYEVIDDAKTQLEAACAGVVSCADILALAARDSVFLTNGRSWAMPTGRRDGRVSLASDTANLPGFRDSVDVQKKKFADLGLNTLDLVALVGGHTIGTGACQLFSYRLYNFTSTTSSGADASINPSFVSQLRSLCPQNGDGTRRVALDTGSPSRFDASFFANLRSGRGVLESDQKLWTDASTKTFVQGFLSGQGPTRLDFNTEFAKSMVKMSNIGVKTGTNGEIRKICSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTTGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCACGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGACCAACGCTGAGAAAATGGCAGGTCCAAACCGTTTGTTGAGAGGATATGAAGTGATCGATGACGCAAAGACTCAACTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
GTACTTTATAATCTCGTGCTTCCATTTATTAGAGATCTCCGATATGAGTGCAAACCAACGTGGATCAATTTC
ATTCACTTCTACGCAAATCTTGGCGACGGCAACATGATTGATATCTTTTAATTGCAAAGATTCTTCAAATATTTGAGATATCTTGAGTGATGTGATTCATGAAATTCAATGCAGACGAAT
GGACGAAGTTGGGCCATGCCGACGGGACGCAGAGATGGGCGGGTCTCCTTGGCATCAGATACTGCAAATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGAC
TTAGGACTGAACACCCTTGATCTCGTTGCTCTCGTTG
GTCAGTATTTTCAATTTGTCGCCATTTCAATTTACTATCCAGCAGTACAGAAGTTGGCAACCGAATGCGTTATACTGCAGCAT
TTCCAAACCTAATTATTTTTCTCCCGTCTGCTGAATCTAAGGACAACTCCGCCCGTCGGTAGTTGTTATATTTCTTCTTGTCCTGTTGTTAAGGACGACTGTGGCTGTCCCTAAAATCTG
ATTAATCTTCTTTCTAATTTCCTTTAAGAGCTGTAAACATGAAGTTTATTTGTCATAGGTAAGAGAGAATAGACATATTAAAAACTTGTCGACTTATCGCTTCTTGCTATCTCGTAATTA
AATCGAGTCTTCCCATATGTCCATGCGCATCAAAAGGGATACACTGAGTTTCTTTGCTTTTGACCAATACGCGATACAGGAGGGCACACCATAGGAACTGGAGCTTGCCAGTTATTTAGC
TACAGACTCTACAATTTCACCAGTACTACATCGAGTGGAGCCGATGCTTCCATCAATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGCACGAGGCGTGTT
GCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAGAAGCTATGGACGGATGCCTCCACCAAAACCTTC
GTGCAGGGTTTTCTAAGCGGCCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGTGTGAAGACGGGGACCAATGGTGAAATTAGG
AAAATATGCTCCGCCATTAATGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGGTTGCTTCTTTCCCAACAAAGCCGCCTTGTTCATGATGCTTCTTACGGTATGCATTGCACCAACCTTGGTACAAGGACAAGGTACGAGAGTAGGGTTCTACTCAAGTTCGTGT
CCACGTGCCGAGGCCATTATTAGGTCGACCGTTCAAGCCCATTTCAAATCTGATCCCACCGTGGCTCCGGGGTTGTTGAGGATGCACTTTCACGACTGCTTTGTCCAAGGATGCGACGGT
TCCATCCTCATCGATGGGACCAACGCTGAGAAAATGGCAGGTCCAAACCGTTTGTTGAGAGGATATGAAGTGATCGATGACGCAAAGACTCAACTCGAAGCTGCATGTGCCGGCGTCGTT
TCATGTGCTGATATTCTCGCTCTTGCAGCCCGTGATTCCGTTTTTCTG
ACGAATGGACGAAGTTGGGCCATGCCGACGGGACGCAGAGATGGGCGGGTCTCCTTGGCATCAGATACTGCA
AATTTGCCAGGTTTCCGGGATTCAGTTGATGTGCAAAAGAAAAAGTTTGCCGACTTAGGACTGAACACCCTTGATCTCGTTGCTCTCGTTG
GAGGGCACACCATAGGAACTGGAGCTTGC
CAGTTATTTAGCTACAGACTCTACAATTTCACCAGTACTACATCGAGTGGAGCCGATGCTTCCATCAATCCTTCCTTTGTTTCTCAACTCCGGTCTCTGTGTCCACAAAACGGTGATGGC
ACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAGAAGCTATGGACGGATGCCTCC
ACCAAAACCTTCGTGCAGGGTTTTCTAAGCGGCCAAGGCCCGACCCGGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAACATTGGTGTGAAGACGGGGACCAAT
GGTGAAATTAGGAAAATATGCTCCGCCATTAATGCA

Retrieve as FASTA