Entry information : EcamPrx59 ( EcC049213.50)
Entry ID 10285
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EcamPrx59 ( EcC049213.50)
Name (synonym) EcamPrx59 ( EcC049213.50)
Class Class III peroxidase     [Orthogroup: Prx023]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx59
start..stop
S start..stop
EglPrx59 568 0 3..334 1..332
EgrPrx59 567 0 3..334 1..332
EguPrx59 566 0 3..334 1..332
VvPrx57 424 5e-150 1..333 1..336
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7..225 219 N° 2 1087..1275 189 N° 3 1605..1776 172 N° 4 2176..2600 425
join(7..225,1087..1275,1605..1776,2176..2600)


exon

Literature and cross-references EcamPrx59 ( EcC049213.50)
Protein sequence: EcamPrx59 ( EcC049213.50)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (306)
PWM (Da):   %s   32449.03 (29131.3)  
PI (pH):   %s   7.75 (5.65) Peptide Signal:   %s   cut: 29 range:29-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMSRGASFRSWSLRWVFLLICFVGGKSQLTTDFYSTTCPNLLSIVRKEVQNAIKAEMRMGASLLRLHFHDCFVNGCDGSVLLDGSDGEKFAGPNLNSARGFDVVDxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxSGGPTWKVPLGRRDGLVANQTGSNNGLPAPTDPLDTIISKFAAVGLNVTDVVALSGGHTIGLARCATFSNRLFNFSANSGSDPTLDTTMTSDLQSLCPVNGDGNKTTALDRNSTDLFDNHYFKNLAVNKGLLSSDQVLYSGDSSTASSTTKSLVESYGSNPNLFITDFTNSMIKMGSISPLTGSNGEIRKNCRVVNSS*

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (PS is missing due to nnnnnnn in DNA).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGTTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACCACTTGTCCTAATCTG
CTCAGCATAGTGAGGAAAGAAGTTCAAAATGCTATCAAGGCTGAAATGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCACGATTGCTTTGTCAAT
GTATGTCATGTGTTTAATATC
ATCGTTGGAACTTGATCGTTATCGTACCACGCAATTAACGACTACGTTTCTTACGTGATCAATTATATAAATTGTTGTTTCAATTTTGTGTTATTGTTCTTCTAAGTGGGCAGTTTCTTG
TAATTCGTAAATATTAATAAGCTTGAGATATTGGTTCTCTTGTTCGTAGGTTCTATTGTGGACTCGAATAGGTTTTTAACAAGTGGAAATAATTGGGAGAATTTGAGTATAGACCTTTGT
TGGTTGTGAATATATTTTCATTTAACTCGTTTCCCTAAGCAATTTCAAATGGCAAATATGAGTAAAATGCTTTTCTGTGATTGATTTTCTGTGAAACTAATATGAGCTATCATCATATGC
ACTTAAAATTGAAGTCTAGCTTTTACTCTCACCCAAGACCAAGTCGAGCTATTATTAGAAACACTAGGTTCTAGGAACCCAATGCACTCGATGTGCCACGGTCGTTAAATCATGTGAATT
TCCCGCAAACTCAAACAAAAGATTGATGCACCTGGCAAGGGACATCATTGTTTCGCAAAATAAGTTAGTGAACAAAAAAGGTACTTCTTGACCATTCCAAGAACGAGAAAGTCAATCTCC
TAATCCTCTTTTTGGAACAACAGTAAGTTACCTGCATGTTAGTTTCTCCAGTCATCCTAGGACTTCCTAGTATTCCGAAGGCTAGGGATATGTATATACATCAGAACAGGACATGAGAGG
CTACCCATTCAATCGTCCTCTTTTCCCCATCTTACATTGACTTATCAGCCCTTCATGCTTTCATCATCATTCATGGCTTATATGTTCTCCTGTGAATACTTCACTCTGCTCACACACCAG

GGATGCGATGGATCGGTTCTCCTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACANNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTGGATTCCACCAAAAAATACAAGAATCAACGGGACCCCGTAAACTATAAATAATTTGGTCCACTGTATTCATCGC
AAACTCGGTAAGAAAGTAACTGTATCTGATGGATCCATGTGCAGAGCGGGGGGCCGACATGGAAAGTTCCACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACAATG
GCCTTCCTGCTCCTACCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCACAGATGTGGTAGCTTTATCAG
GTACTCTTCTTTTTCTCTTCCTTTTTTCTT
CTCTCTTTGGATCAGTGCTTTATCCGGTACTTTGAGGACACTCCTCAGTCATTCTAATTTCTATACAAACTGCGTATTGGTATCCCTCGTTCAATCAAGAGGCTAGTTAGTGTCTACCAT
GTTTGATATTTTAACATCCATCTAAAATCAAAGTGATTGTAGTTACTGATCACGCTTAAATTAGGCAGCAAAACTCTGACGGCGTTGTCACCTCTCTGTATGTTCATATCGAATCATGCA
GATCTTGTTGTAAATTATAATCATTTCCAGATCCATCTGAAGTTTCCTGAGAGAGAGCATGTGCAACTCTTAATGGTGTATAGGATGATCATTTCATGCACTGCTGAACAAAAAGAGGTT
TATGTACAGGTGGTCACACAATTGGATTAGCAAGGTGCGCCACCTTCAGCAACAGATTGTTCAACTTTTCGGCAAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACC
TGCAAAGCCTATGCCCTGTGAATGGCGATGGAAACAAGACGACGGCCCTAGACCGCAACTCAACCGATCTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCA
GTTCGGATCAGGTTCTCTATTCTGGTGACAGCAGCACAGCCAGTTCTACTACAAAAAGTCTAGTAGAATCCTATGGTAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGA
TCAAGATGGGAAGCATCAGTCCACTCACTGGTTCAAATGGCGAGATTCGGAAGAACTGTAGAGTGGTTAACTCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGTTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACCACTTGTCCTAATCTG
CTCAGCATAGTGAGGAAAGAAGTTCAAAATGCTATCAAGGCTGAAATGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCACGATTGCTTTGTCAAT
GGATGCGATGGATCGGTTCTC
CTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
GTGCAGAGCGGGGGGCCGACATGGAAAGTTCCACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGT
TCAAACAATGGCCTTCCTGCTCCTACCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCACAGATGTGGTAGCTTTATCAG
GTGGTCACACAATTGGATTA
GCAAGGTGCGCCACCTTCAGCAACAGATTGTTCAACTTTTCGGCAAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGCCTATGCCCTGTGAATGGCGAT
GGAAACAAGACGACGGCCCTAGACCGCAACTCAACCGATCTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGATCAGGTTCTCTATTCTGGTGAC
AGCAGCACAGCCAGTTCTACTACAAAAAGTCTAGTAGAATCCTATGGTAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATGGGAAGCATCAGTCCACTCACT
GGTTCAAATGGCGAGATTCGGAAGAACTGTAGAGTGGTTAACTCT

Retrieve as FASTA