Entry information : EcamPrx158 (EcC049645.20)
Entry ID 10286
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx158 (EcC049645.20)
Name (synonym) EcamPrx158 (EcC049645.20)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx158
start..stop
S start..stop
EglPrx158 644 0 1..316 1..316
EgrPrx158 644 0 1..316 1..316
EguPrx158 627 0 1..316 1..316
PpePrx30 526 0 1..316 1..318
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 305..493 189 N° 3 1008..1170 163 N° 4 1304..1695 392
join(1..204,305..493,1008..1170,1304..1695)


exon

Literature and cross-references EcamPrx158 (EcC049645.20)
Protein sequence: EcamPrx158 (EcC049645.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316 (294)
PWM (Da):   %s   33693.05 (31473.8)  
PI (pH):   %s   8.92 (8.92) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAIGVALFSSLLVLSFVSPISSLSSNYYDKTCPNAELIVANAVKNAAMKDKTVPAALLRMHFHDCFIRGCDASVLLNSKGSNKAEKDGPPNVSLHSFFVIDNAKKELEASCPGVVSCADILALAARDSVVLSGGPTWDVPKGRKDGRTSKASETTQLPAPLFNISQLQQSFSQRGLSMEDLVALSGGHTLGFSHCSSFAGRIRNFNTTHDIDPSMHPSLAASLRGVCPSKNRPKNAGTTMDSSSTTFDNTYYRLILQGKGLFSSDQALLAVPKTKDLVEKFAGSHKEFTDAFVKSMIKMSSITGGGEVRKDCRVV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGGTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGTTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTTGCA
AATGCTGTCAAGAATGCAGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCATGACTGTTTCATTAGG
GTAAGCAAACGTGTCTGATGGTTCTCTATCTGTTTC
AGATTTCTTACACAAAGCTTCCTTAGTTATCAGAACTCAACAGATAGTTCTGTATCTGTTTCAGGGTTGCGACGCGTCGGTGCTTTTAAACTCCAAAGGAAGCAACAAAGCGGAGAAGGA
TGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATGCCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATCTTGGCACTAGCTGCTAGAGA
TTCCGTCGTACTG
GTAAAATCTCTCCTCATCCACTTTGTTACGTGTATATCCCGATTCTTCACGACCAACCAATCCCTCCAGCATAGCTTGTCACTGAGATTGTCCTGAAAATCCACCCT
AAACCGTCTAAAACATAAACGCTGATGTCTTGGAAACATCTTAGGGCCAAGTGTAGGGATCCTGTCCAATCCTGAGCTTACTGCGCAATGTCCTGGACAGTCTTCACGCAGGTCTCTATC
CTGGAAAATAATAGAGAAACCAGGCAGGACGGTGTTAAGCTACCAACTCTTGGGAATGTCTGCTTGCACCGCAAGGGATAGATACATATTCACTCAATATGTGCATAAATAGGTTTAAAC
AGGACCAAACGGAAGTCGGCCTACTGGAAGCTAAATCAATGCCCACTGAACAAATCCCTTCCCCCAGTAGCAATTTTAGCCGTAATTTCTCGACTAGAAGGTTCCCTTGTGCACAGCATA
TTGCGTATCTCACTGAGATTTTCTTTCATTTCTGATGCGTAAAAAAGTCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGACGACTC
AACTCCCAGCACCACTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
GTATAACAAATAATCAAACGGACCAATATA
TGACGGTGTTTTGTCGAGAAATTCACTCTGCCAGATTCATTCATTTGTTTTGGTTTTTCACCTGTGCTGATTCTGATCTCAACTTCTATCCCTCCCCTTGCAGGAGGCCACACACTAGGA
TTTTCCCACTGCTCCTCCTTCGCAGGCAGGATCCGCAACTTCAACACCACGCACGACATCGACCCATCGATGCACCCATCCCTGGCAGCGAGCCTAAGAGGCGTGTGCCCGAGCAAGAAC
AGGCCAAAAAACGCAGGGACCACCATGGACTCTTCCTCAACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAAGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGGCAGTG
CCCAAGACGAAGGATCTGGTCGAGAAGTTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGAAGGAC
TGCAGGGTAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCATCGGTGTTGCACTCTTCAGCTCGCTTCTTGTACTTTCATTTGTCTCTCCAATCTCTTCACTAAGTTCCAATTACTACGACAAGACCTGTCCCAATGCTGAGTTGATCGTTGCA
AATGCTGTCAAGAATGCAGCAATGAAGGACAAAACCGTTCCGGCTGCTCTTCTGCGGATGCATTTTCATGACTGTTTCATTAGG
GGTTGCGACGCGTCGGTGCTTTTAAACTCCAAAGGA
AGCAACAAAGCGGAGAAGGATGGACCTCCTAATGTCTCTCTGCACTCATTTTTTGTAATCGACAATGCCAAAAAGGAGTTGGAAGCTTCTTGCCCCGGCGTGGTTTCATGTGCGGACATC
TTGGCACTAGCTGCTAGAGATTCCGTCGTACTG
TCCGGAGGTCCGACTTGGGATGTGCCCAAGGGAAGGAAGGATGGAAGAACATCAAAAGCCAGCGAGACGACTCAACTCCCAGCACCA
CTTTTCAACATTTCTCAGCTCCAGCAGAGCTTCTCCCAGAGAGGCCTCTCTATGGAAGATCTCGTCGCTCTTTCGG
GAGGCCACACACTAGGATTTTCCCACTGCTCCTCCTTCGCAGGC
AGGATCCGCAACTTCAACACCACGCACGACATCGACCCATCGATGCACCCATCCCTGGCAGCGAGCCTAAGAGGCGTGTGCCCGAGCAAGAACAGGCCAAAAAACGCAGGGACCACCATG
GACTCTTCCTCAACCACCTTCGACAACACGTACTACAGGCTGATCCTCCAAGGGAAGGGCCTGTTCTCTTCGGACCAGGCCCTCCTGGCAGTGCCCAAGACGAAGGATCTGGTCGAGAAG
TTCGCAGGCTCGCACAAGGAATTCACGGATGCATTCGTCAAGTCCATGATCAAGATGAGCAGCATCACAGGCGGAGGGGAAGTTAGGAAGGACTGCAGGGTAGTCAAT

Retrieve as FASTA