Entry information : OsPrx19
Entry ID 1029
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx19
Name OsPrx19
Class Class III peroxidase    [Orthogroup: Prx155]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx19
start..stop
S start..stop
BdiPrx94 486 1e-174 1..336 1..335
ZmPrx124 477 9e-171 25..336 34..342
SiPrx13 474 1e-169 16..336 26..343
SbPrx67 473 3e-169 25..336 39..348
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 33377206..33377442 237 N° 2 33376848..33377033 186 N° 3 33376566..33376731 166 N° 4 33376012..33376433 422
complement(join(33376012..33376433,33376566..33376731,33376848..33377033,3337720 6..33377442))


exon

Literature and cross-references OsPrx19
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q8S130
DNA ref. GenBank:   NC_008394.1 (33377442..33376015)
Protein sequence: OsPrx19
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (318)
PWM (Da):   %s   37003.24 (35312.2) Transmb domain:   %s   i2-24o
PI (pH):   %s   4.69 (4.69) Peptide Signal:   %s   cut: 19 range:19-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALLGVLVGAVIIVVATAAAVSGSGLPVPGYDGLAIGFYHETCPQAEDLVLAEMREIVQEDRTLAPALLRFMLHDCFVRGCDASIMLKSREKIGERDANSSYSLRGYEQIERIKAKLEDECPMTVSCADIIVMAARDAVFLSNGPRYQVETGRRDGKVSCTIDADNDLPPPGSNIVDLKIYFSVKNLGWKDLVVLSGSHTIGRAQCGSFARDRLYNYSGEGRQDPSLNTAYAPELRKACVAGDPFDKTYVDMDPGSPYTFDLSYYRDVYRNRGLFVSDQALLNDKWTKQYVERMASADSTDEYFRDYAEAMTNMGRIEVLTGDNGEIRKVCGAYVD

Retrieve as FASTA  
Remarks chromosome 1. 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGTTGGGCGTCCTCGTCGGGGCGGTGATCATCGTCGTCGCCACCGCGGCCGCCGTTTCGGGCAGCGGGCTGCCGGTGCCTGGATACGACGGGCTCGCCATCGGGTTCTACCAC
GAGACGTGCCCACAGGCGGAGGACCTGGTGCTCGCCGAGATGAGGGAGATCGTCCAGGAGGACAGGACCCTCGCGCCGGCGCTCCTGCGGTTCATGCTCCACGACTGCTTCGTCAGG
GTG
CGTGCCTCGCGTGCTCGATCCCTTCCTCAGTTTCTCATCATGTCGCGTGGCGTCGCGGGGACGAACCCTCGTGCGTCGATGTCGCGTCGCCGTGGTGCGTGCTGCTGATCAATGGACGAT
GGGTTTTTGATGATATGTTTGTGCTTGCTTGGCTTCGCGTGGCGTGCAGGGGTGTGACGCGTCCATCATGCTGAAATCGCGGGAAAAAATCGGGGAGAGGGACGCCAACTCGAGCTACAG
CCTCCGCGGCTACGAACAGATCGAAAGGATCAAGGCCAAGCTGGAAGATGAGTGCCCGATGACCGTGTCGTGTGCGGACATCATCGTCATGGCCGCGCGGGACGCCGTGTTCCTG
GTAAT
GACGCCAACTCCCTGGCTACTTTAATTCGAGATCAGTAGTATAATCCGATCGCCGTGATCTTTATTATCGTTCATCCCGACGTACGTTGACGAGCGGCTTCGTTTTACCAGAGCAACGGC
CCACGGTACCAGGTGGAGACCGGACGCCGGGACGGCAAGGTGTCCTGTACCATTGACGCCGACAACGATCTCCCACCGCCCGGCTCCAACATTGTCGACCTCAAGATCTACTTTAGTGTC
AAGAACCTGGGATGGAAGGACCTCGTCGTCCTATCAG
GTACGCAATACCGCAAATACCAGCGTCCAGTAGTACTTTTGGTCAGTGCGAGCAAAAGCACACACAATATCCATTCACCAGCT
TCAATTTCTGCTCGATTTTGCGCGTGATTTTGTGCGTGATTTTCCGCAGGGAGCCACACGATAGGGAGGGCGCAGTGCGGCTCGTTCGCGCGCGACAGGCTGTACAACTACAGCGGGGAA
GGGAGGCAGGACCCGTCGCTGAACACGGCGTACGCGCCGGAGCTGAGGAAGGCGTGCGTGGCCGGCGACCCTTTCGACAAGACGTACGTGGACATGGACCCGGGGAGCCCGTACACGTTC
GACCTGAGCTACTACCGGGACGTGTACAGAAACAGGGGCCTCTTCGTCTCCGACCAGGCCCTCCTCAATGACAAGTGGACCAAGCAGTACGTGGAGAGGATGGCGTCCGCGGATTCGACG
GACGAGTACTTCAGGGACTACGCGGAGGCCATGACCAACATGGGGAGGATCGAGGTGCTCACCGGCGACAACGGCGAGATCAGGAAGGTGTGCGGCGCGTACGTTGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATTGTTGGGCGTCCTCGTCGGGGCGGTGATCATCGTCGTCGCCACCGCGGCCGCCGTTTCGGGCAGCGGGCTGCCGGTGCCTGGATACGACGGGCTCGCCATCGGGTTCTACCAC
GAGACGTGCCCACAGGCGGAGGACCTGGTGCTCGCCGAGATGAGGGAGATCGTCCAGGAGGACAGGACCCTCGCGCCGGCGCTCCTGCGGTTCATGCTCCACGACTGCTTCGTCAGG
GGG
TGTGACGCGTCCATCATGCTGAAATCGCGGGAAAAAATCGGGGAGAGGGACGCCAACTCGAGCTACAGCCTCCGCGGCTACGAACAGATCGAAAGGATCAAGGCCAAGCTGGAAGATGAG
TGCCCGATGACCGTGTCGTGTGCGGACATCATCGTCATGGCCGCGCGGGACGCCGTGTTCCTG
AGCAACGGCCCACGGTACCAGGTGGAGACCGGACGCCGGGACGGCAAGGTGTCCTGT
ACCATTGACGCCGACAACGATCTCCCACCGCCCGGCTCCAACATTGTCGACCTCAAGATCTACTTTAGTGTCAAGAACCTGGGATGGAAGGACCTCGTCGTCCTATCAG
GGAGCCACACG
ATAGGGAGGGCGCAGTGCGGCTCGTTCGCGCGCGACAGGCTGTACAACTACAGCGGGGAAGGGAGGCAGGACCCGTCGCTGAACACGGCGTACGCGCCGGAGCTGAGGAAGGCGTGCGTG
GCCGGCGACCCTTTCGACAAGACGTACGTGGACATGGACCCGGGGAGCCCGTACACGTTCGACCTGAGCTACTACCGGGACGTGTACAGAAACAGGGGCCTCTTCGTCTCCGACCAGGCC
CTCCTCAATGACAAGTGGACCAAGCAGTACGTGGAGAGGATGGCGTCCGCGGATTCGACGGACGAGTACTTCAGGGACTACGCGGAGGCCATGACCAACATGGGGAGGATCGAGGTGCTC
ACCGGCGACAACGGCGAGATCAGGAAGGTGTGCGGCGCGTACGTTGACTAG

Retrieve as FASTA