Entry information : EcamPrx131 (EcC049934.20)
Entry ID 10290
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx131 (EcC049934.20)
Name (synonym) EcamPrx131 (EcC049934.20)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx131
start..stop
S start..stop
EguPrx131 660 0 13..339 1..327
EgrPrx131 655 0 13..339 1..327
EglPrx131 650 0 13..339 1..327
VvPrx19 496 2e-178 3..339 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..258 258 N° 2 361..552 192 N° 3 669..834 166 N° 4 1106..1506 401
join(1..258,361..552,669..834,1106..1506)


exon

Literature and cross-references EcamPrx131 (EcC049934.20)
Protein sequence: EcamPrx131 (EcC049934.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (317)
PWM (Da):   %s   36328 (33910.6)  
PI (pH):   %s   4.57 (4.50) Peptide Signal:   %s   cut: 23 range:23-339
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRVAVRLAFFLAMLELSVVALSKSPTTSREECADDHNASPLSTTFYDDTCPEAEAIIFAWVDRAVSEDPRMAASLLRLHFHDCFVNGCDASVLLDDIGGFVGEKTAGPNLNSLRGFEVVDAIKSELETVCPSTVSCADILASAARDSVLVSGGPGWDVLMGRRDSLGASRDAANNNIPAPNSTVEILVAKFQSAGLTLNDMVALSGAHTMGKARCPTFRSRLAGSAHSTGPKVNLEFLQSLQQLCSGPNSNSTLAELDLVTPATFDNQYYVNLVSGEGLLQSDQVLFAGDDRTRQIVESYAEDPLTFFEDFKRSMVRMGSLGPLTGKEGEIRRNCRIV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGTGGCCGTGCGTTTGGCTTTCTTCTTGGCCATGCTTGAGCTGAGTGTCGTTGCCCTTTCGAAATCACCCACCACCTCGCGTGAAGAATGTGCAGACGATCACAATGCGAGCCCC
TTGAGTACCACTTTCTATGACGACACGTGCCCCGAAGCGGAGGCGATCATCTTTGCATGGGTCGATAGGGCGGTCTCCGAGGACCCGAGGATGGCCGCTTCGCTGCTGCGCCTTCATTTT
CATGACTGTTTCGTCAAT
GCAAGTTTTGAAATCGATATTGTCGTGGCATTTTCTCTTTCCAAATGTTCAAGTGAATAAGTTCAAGGTTCTCTTTTTTCTGTCAAATTATTTTTCGTGCAG

GGATGCGATGCTTCTGTGCTTTTGGATGACATTGGAGGTTTCGTGGGAGAGAAGACCGCCGGACCAAACTTGAATTCCTTGAGGGGGTTCGAAGTGGTCGACGCTATAAAATCTGAGCTT
GAAACTGTTTGTCCTAGTACAGTTTCATGTGCCGATATCCTAGCAAGTGCTGCCAGAGACTCTGTTTTAGTG
GTAGGTTTTCAATCCGAAAGGGACGCTTAGGTACTCCGTAACTTATAA
AATTTCTCAACTTTGAAGAGGGTTGTTAAGATATTACAGTCTAAGCTGATACTTAGAATGAATCGCAGTCGGGCGGGCCTGGATGGGATGTTCTAATGGGTCGGAGAGACAGCTTAGGCG
CCAGCAGAGACGCAGCGAACAACAACATTCCGGCGCCGAATTCCACCGTGGAGATATTGGTTGCTAAGTTTCAGAGTGCTGGTCTCACCCTCAACGACATGGTCGCCCTATCTG
GTATCT
TCTCCTGTTTATTATCCGATTCCCTAGTTTTGCACATCATGCCCTTCAAGCGCTTGAAAATTCACCTAGTGCAATGCCATTTTTAGAGGAAATAATTAGACGCGACGATGTAGAAACGTA
GCGTCAACATGTTTTTTCCAGGTTACTATTAGGCGTACGTCGCAGCAACCTGGTATTTAATGTTTAGGAACTTGGGTGATGAGACCAAGTCTGCACATGCTAACAATACTGGAATTAGAA
AGGATCGTTTGCTACTTTCACGCAGGTGCGCATACTATGGGAAAGGCTAGGTGCCCGACATTTAGATCACGGCTCGCGGGCAGTGCCCACTCGACCGGTCCAAAGGTCAACCTGGAGTTC
CTTCAGTCACTGCAGCAGCTTTGCTCGGGTCCCAATAGCAATTCGACTCTAGCAGAGCTCGATCTGGTGACGCCGGCGACTTTCGACAACCAGTACTATGTGAACCTTGTCTCAGGAGAG
GGGCTGCTTCAGTCCGACCAGGTTCTCTTTGCCGGAGACGACAGAACGAGGCAAATAGTGGAGTCCTATGCAGAGGACCCCCTGACGTTCTTCGAGGATTTCAAGCGCTCGATGGTGAGA
ATGGGGAGCCTGGGGCCGCTCACGGGTAAAGAGGGCGAAATCAGAAGAAATTGTAGAATCGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGGTGGCCGTGCGTTTGGCTTTCTTCTTGGCCATGCTTGAGCTGAGTGTCGTTGCCCTTTCGAAATCACCCACCACCTCGCGTGAAGAATGTGCAGACGATCACAATGCGAGCCCC
TTGAGTACCACTTTCTATGACGACACGTGCCCCGAAGCGGAGGCGATCATCTTTGCATGGGTCGATAGGGCGGTCTCCGAGGACCCGAGGATGGCCGCTTCGCTGCTGCGCCTTCATTTT
CATGACTGTTTCGTCAAT
GGATGCGATGCTTCTGTGCTTTTGGATGACATTGGAGGTTTCGTGGGAGAGAAGACCGCCGGACCAAACTTGAATTCCTTGAGGGGGTTCGAAGTGGTCGAC
GCTATAAAATCTGAGCTTGAAACTGTTTGTCCTAGTACAGTTTCATGTGCCGATATCCTAGCAAGTGCTGCCAGAGACTCTGTTTTAGTG
TCGGGCGGGCCTGGATGGGATGTTCTAATG
GGTCGGAGAGACAGCTTAGGCGCCAGCAGAGACGCAGCGAACAACAACATTCCGGCGCCGAATTCCACCGTGGAGATATTGGTTGCTAAGTTTCAGAGTGCTGGTCTCACCCTCAACGAC
ATGGTCGCCCTATCTG
GTGCGCATACTATGGGAAAGGCTAGGTGCCCGACATTTAGATCACGGCTCGCGGGCAGTGCCCACTCGACCGGTCCAAAGGTCAACCTGGAGTTCCTTCAGTCA
CTGCAGCAGCTTTGCTCGGGTCCCAATAGCAATTCGACTCTAGCAGAGCTCGATCTGGTGACGCCGGCGACTTTCGACAACCAGTACTATGTGAACCTTGTCTCAGGAGAGGGGCTGCTT
CAGTCCGACCAGGTTCTCTTTGCCGGAGACGACAGAACGAGGCAAATAGTGGAGTCCTATGCAGAGGACCCCCTGACGTTCTTCGAGGATTTCAAGCGCTCGATGGTGAGAATGGGGAGC
CTGGGGCCGCTCACGGGTAAAGAGGGCGAAATCAGAAGAAATTGTAGAATCGTCAAC

Retrieve as FASTA