Entry information : EcamPrx16 (EcC050829.20)
Entry ID 10291
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: EcamPrx16 (EcC050829.20)
Name (synonym) EcamPrx16 (EcC050829.20)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx16
start..stop
S start..stop
EcamPrx01 694 0 1..337 1..337
EgrPrx16 694 0 1..337 1..337
EgrPrx01 692 0 1..337 1..337
EglPrx16 691 0 1..337 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..243 243 N° 2 425..610 186 N° 3 758..917 160 N° 4 1035..1456 422
join(1..243,425..610,758..917,1035..1456)


exon

Literature and cross-references EcamPrx16 (EcC050829.20)
Protein sequence: EcamPrx16 (EcC050829.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337
PWM (Da):   %s   37215.44  
PI (pH):   %s   6.17
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRWGLLLLLSELALVSLYAVQHVEAAEGLEPPLTLKWHYYRNSCRDAETYVRHQVEYYWKPDKSLTPKLLRLLYSDCFVTGCDASILLDGRNSEKTAPQNSGLEGYGTVVIDKIKQVLEQRCPGVVSCADILNLAARDAAHLAGAPSYPVLTGRRDGMSSSKASVDLPSPSISWEEALAYFESRNLDVLDLATLLGAHSMGKTHCSYITDRLYNYNSTGKPDPDMDPSYLAQMRKQCPPNSKSQGDPQVFLDPASGSSYTFSNSYYSRLLNHQATLGIDQQLARGDDTSQIAQEYDAGLEDFRKEFALSMARMGNIKVLTGNQGEIRKNCRAVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa. containing motif YSDC.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTGCTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCCTCTACGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTTGAGCCGCCGCTGACACTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTACGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCGTC
ACG
GTACGTATCGTCCGTTGTCATCGCTTTCATACCGAGTTTCAGTAGGCTTTCTGAGCTCTCGAAATGGGCTTTCTAACGTATAATAATGGTGGAAACCGGGCATGTACGTGCAATAAC
TTGTTTTTTTCTTTAATAAACAAAGCCTTGGATTGAGATACGTTTGGCTACCTGTGTAAAACAGGGCTGTGATGCGTCTATTCTGTTAGACGGGCGAAATTCAGAGAAAACAGCGCCACA
AAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGC
CGCTCACTTG
GTATGTGCCTGGTTTGCAGTTCTCTTCTTTGGCTTCAAAAGAGATTATTTTCACTGCCCTACCGATCATTGAAATGCTGCTAGCTTGAACTTGTAGTATTAGATGTGAAA
AACCAGAATCGCTGACACGATAATGTTTTTCTCACAGGCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCGTCATCCAAGGCGTCGGTGGACCTCCCGTCGCC
ATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GTAAGATGGATCATTGTATAAAAAAAGTAAATAATTGATTTGG
ACCTCATCAAGTCATCGCTTTTTGAAACATTAAAATCAATTCCTAACTTTGCGCAAAAATATGAAATTGGACAGGGGCTCATTCAATGGGCAAGACTCACTGCAGCTACATCACAGACAG
GCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCAAACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCT
TGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGACCAGCAGCTCGCCCGCGGTGACGACACTTCCCAGAT
CGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAG
AGCCGTGAACAGCAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTGCTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCCTCTACGCGGTGCAGCACGTCGAGGCAGCAGAGGGGCTTGAGCCGCCGCTGACACTGAAGTGGCACTAC
TACCGGAACTCGTGCCGCGATGCTGAGACGTACGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTGCTCTACTCTGACTGCTTCGTC
ACG
GGCTGTGATGCGTCTATTCTGTTAGACGGGCGAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAA
CAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCG
TCATCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GGGCTCATTCA
ATGGGCAAGACTCACTGCAGCTACATCACAGACAGGCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCA
AACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGAC
CAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGCAAA

Retrieve as FASTA