Entry information : EcamPrx15 (EcC050829.30)
Entry ID 10292
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: EcamPrx15 (EcC050829.30)
Name (synonym) EcamPrx15 (EcC050829.30)
Class Class III peroxidase    [Orthogroup: Prx056]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx15
start..stop
S start..stop
EgrPrx15 689 0 1..334 1..334
EgrPrx02 686 0 5..334 1..330
EguPrx02 682 0 5..334 1..330
EglPrx15 642 0 1..333 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..246 246 N° 2 441..626 186 N° 3 789..948 160 N° 4 1204..1613 410
join(1..246,441..626,789..948,1204..1613)


exon

Literature and cross-references EcamPrx15 (EcC050829.30)
Protein sequence: EcamPrx15 (EcC050829.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334
PWM (Da):   %s   37221.99  
PI (pH):   %s   7.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRASMWWQLLLSALALLRSCQAQPIEAKATIKLPPPLQWHFYQNSCPDVEKYVRDQVEFYWKQDSTLAPKLIQLLYTDCFIKGCDASVLLDGPDAEKTAPQNAAILGFPLEVIDKVKEVLEQHCPGVVSCADIINLAARDAVVLAGGVSYPVPTGRRDGNSSNAKLVDLPKRAVPWEKVIPYFKIRGLDVFDVTTLLGGHTLGRTSCEFIAERLYEFNNTGKPDPSMDPSFLAELRVQCPPNSTNSVYLNPDSGSSNRFSKTFYSRVLNHRAVLSIDQQIAAHKESLQIARRYDANFEDFLKMFGYSMTKLGNTWLLPGDQGEIRKNCRVVNG

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa. containing motif YTDC
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCCAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCAT
TTCTACCAGAACTCGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTC
ATCAAG
GCACGTACCGTCTGTTCATTTCCTTCTTTCTGTCTCTCTCACGATCTTGAAGTCGGCATCACTTTAATCATCGAGTTTCCGTTGCCCTATCTAAGCATGCCAAATCCTTTCACC
CGTTGGTTTAACTTCTCGAACTGGGCTTTCTAATATACCACTCTTTTGTGTACGTATGTATGGTTATGTGGATAAAACAGGGATGCGATGCGTCGGTTCTCTTGGACGGGCCAGATGCAG
AGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCGGGGTTGTCTCTTGCGCCGACATTATCAACC
TTGCCGCTAGAGATGCTGTCGTCTTG
GTATGCAGCATGGTTCTCAGTTTTTCCTTTTTGAGCTGGAAAAGAGATTGTTTGGGCTGCTGCACTGATGATAATCGACGTGCTGTTAGCTTGA
GTTTTGGAGCGTTCGATATGGAAAGGAAAAAAATTAGAATTACTAATGTGATAATGATGTTGTAATAGGCTGGAGGGGTGTCGTACCCCGTTCCGACGGGGAGGAGGGACGGAAATTCGT
CCAACGCGAAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATGTGTTCGACGTCACCACTCTACTTG
GTATGGTCTAAC
CCTCGAACGAAAAGTGTTTATTTGACTCCGACCTCGTTACATTACCTTAAGATCTTAACCAATCCAAGCAACTCAGTTAGTTCAGTGAATCACGCTGTCCCCTTTAGCTTTCATGTGATC
CGAACCAATCCTCCCAATGATCTCCTCCAAGTGCACAAAAATGGCATGCTCACGTATCATGTCAAACTCTCAATCATAACCAATTCCTCCTAACTTTTCCAAAAAAAACTTAAATTTTGC
CAGGGGGGCATACACTGGGCAGGACCAGCTGCGAGTTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGG
TGCAATGCCCGCCAAACTCAACGAATTCAGTGTACCTAAACCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCG
ACCAGCAGATCGCCGCCCATAAGGAGAGCCTCCAGATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCC
TACCAGGGGATCAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAGCATCAATGTGGTGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCCAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCAT
TTCTACCAGAACTCGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTC
ATCAAG
GGATGCGATGCGTCGGTTCTCTTGGACGGGCCAGATGCAGAGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTG
GAACAGCATTGTCCCGGGGTTGTCTCTTGCGCCGACATTATCAACCTTGCCGCTAGAGATGCTGTCGTCTTG
GCTGGAGGGGTGTCGTACCCCGTTCCGACGGGGAGGAGGGACGGAAAT
TCGTCCAACGCGAAGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATGTGTTCGACGTCACCACTCTACTTG
GGGGGCAT
ACACTGGGCAGGACCAGCTGCGAGTTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCG
CCAAACTCAACGAATTCAGTGTACCTAAACCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATC
GCCGCCCATAAGGAGAGCCTCCAGATTGCCCGGCGGTACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGAT
CAGGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAA

Retrieve as FASTA