Entry information : EcamPrx[P]47 ( EcC050920.30)
Entry ID 10295
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-21 (Christophe Dunand)
Peroxidase information: EcamPrx[P]47 ( EcC050920.30)
Name (synonym) EcamPrx[P]47 ( EcC050920.30)
Class Class III peroxidase    [Orthogroup: Prx267]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]47
start..stop
S start..stop
EgrPrx[P]47 461 4e-165 1..316 1..323
EglPrx[P]47 461 5e-165 1..316 1..322
EguPrx[P]47 434 1e-154 1..316 1..323
EglPrx48 287 1e-96 19..307 21..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..198 198 N° 2 1570..2315 746  
join(1..198,1570..2315)


exon

Literature and cross-references EcamPrx[P]47 ( EcC050920.30)
Protein sequence: EcamPrx[P]47 ( EcC050920.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   316
PWM (Da):   %s   34202.58  
PI (pH):   %s   10.03
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKMITIFLGFIFLLPQGLGNLKVGFYNFICPRAESIVHQVVRSRFQADQSITAALLRMHFHECFVRGCDASILIDSTDSNPLKKSAAPNLTVRGFEIIDEAKKNIEASCPSMVSCADIATLAxTRYAVFLAGGPSYDVATGRRDGIISARDEVNLPGPTFSQQKDSLLPKWSFSWVDTPLESLTTRPYLRFMxGTGAPDRSMDPSLIMKLKVTCGASSSSDPTVSLDQSTPSSSITSSIARFLRREGYCKLIRSSLLINRPRQSSLSTGWTQNGFRLSFAIAMVKMSNVGVLTGNAG*IGKNCRVFQLARMLRQLG

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (frame shift and stop in frame). Incorrect prediction from kazusa (5' end is missing which has been completed manully). The same with EcC039920.40 (Removed) at DNA level.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGATAACTATCTTTCTCGGGTTCATTTTTCTTCTTCCTCAGGGTTTGGGCAATCTGAAGGTCGGCTTCTACAACTTTATTTGCCCGCGAGCTGAGTCCATCGTCCATCAGGTC
GTGCGGAGTCGATTCCAAGCCGACCAATCCATCACGGCTGCCTTGCTCCGCATGCATTTCCACGAATGTTTCGTTAGA
GTAAGTTTCGTGCATGTATGTGTCTGCACACGTGCTCTCGAT
GCTAGGATGTAAACTTATAAACATCATATTTATAAAATTGATTTATCTATCATTGTAACGAAATGTGAATAAATTCTGAAATAGGTCAGTCATTGTTAAATGTTTAGTGAAAATCCCTAC
ATCAATCATTTTTGTGTCTTCCAGCATACGTTAGTCAAAGATGATTAGAATCCATGTGCAATTTATAAATAGTTTATGGGTTCTATAGAGTATTTGTCTCAATTTGGATAATAATAAAAA
ATTGGCACGGAATGACACTTAAGTGCCAAAAGTTATGAAAGTAACACTTAAGTACTAAAATTAGATCAAAATGAATCAGTTAAGTGCCAACGGCGAGAAAATCCTACTAAAATGCTGACG
TGGCGATTTTCCGGTGAAGCAAGTGCAAAACGATAACGTTTTGCACGTTGATGTGGCTAGACAAATGTAAAAACAACATCGTTTTGTTATTGACGTGACTAAATAAATAATATAAAATTT
ATTAAATTAAATTTAAAACTAACATATATATATATATATATTTTTTTTAGAAAAAAAAAAGGAAGAAGATGAACAGCGGCTAAGGGCTCAACTCTCGTTGTCGTCACCTCCCCGCTGTCG
ATGGGAAGGGCCGGTGACGTTGGGGGGAGGGTTAGCCGGGGACCTCGGTCGATCAGCGGTGAGGGCCTACGAGCCCTTGCCTAGATCTAGGGGGAGGGTCGTAGCCCTCCCCTAGATTTG
GCGAGGGTTGCCAGCCCTCGCTTGGCTAGGCCAAGAGCCGTCGCTTGTTGGGGGGCCAAGGCCAGCGACCTCGTTGACCATGCCCCCAACGTCGTCAGCCATTCTTCGTGACAACGGGGA
GGGGGTGGCGGCGAGGGTTGAGCCTTTAGCTGTTGTTCATCTTCTTCCTTTCTCTCTCTCTTTAATTTAATTCAACTTAATTAGTTTTCAAATACAAATTTAAATATGTGCCAAAACAAC
ATCTTTTTTGCATTTTTTTGTTGAGTCAGCTCTTCAACAAGCCACATAGGCGAGCAAAATTAATTAAAAATTGCCATGTAGGATTTTTGGCAGCATTCGTCGGAAGTGGCATTCGAGTGT
CCCATTTTTTTTTTAATTTTTAAAAAGTAGCACTTAAGTGTAACTTTTCTAATTTTTGGTACTTAAGTGTCCTATTGTGCCAAGTTTTGGTGCTTGGGGTGTTCTTTTGTTTTGCACAGA
GTATTTGTCTCCATTTGGATACATATTTGTGGAAATTAGAGATTGTATGGATACTGTGATATATGTGCAATTTCAAGAGATATGGATAATCAATAGAGTATTTACTCCTACTTCCTTCCT
CTCATTTAGGGTTGTGACGCATCCATACTCATAGACTCTACCGACAGCAATCCGTTGAAGAAATCCGCCGCCCCGAACCTAACTGTGCGAGGCTTCGAAATCATTGACGAAGCCAAGAAG
AACATTGAAGCCTCATGCCCTTCGATGGTCTCCTGTGCCGACATCGCAACTTTGGCAANNACACGGTACGCGGTCTTCTTGGCAGGAGGGCCTAGCTATGATGTCGCGACGGGAAGGCGA
GATGGCATCATCTCGGCCCGCGACGAAGTTAACTTGCCAGGACCGACATTCTCGCAGCAAAAGGATTCACTCTTGCCGAAATGGTCATTCTCTTGGGTGGACACACCATTGGAATCGCTC
ACTACTAGACCATATCTCAGATTTATGANNGGTACCGGCGCTCCGGACCGATCCATGGACCCAAGCTTGATCATGAAGCTCAAGGTCACCTGTGGCGCTTCATCAAGTAGCGACCCGACC
GTGTCCTTGGACCAGAGCACGCCGTCATCGTCGATAACAAGTTCTATAGCGAGATTCTTGCGAAGAGAGGGATATTGCAAATTGATCAGGAGCTCACTGTTGATAAATCGACCACGGCAA
TCGTCGCTAAGTACGGGTTGGACGCAAAATGGATTTAGGCTGAGTTTTGCAATCGCGATGGTGAAGATGAGCAATGTCGGAGTTCTAACAGGAAATGCTGGATAGATTGGGAAAAACTGT
AGGGTTTTCCAACTAGCTAGAATGCTCCGCCAGTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGATGATAACTATCTTTCTCGGGTTCATTTTTCTTCTTCCTCAGGGTTTGGGCAATCTGAAGGTCGGCTTCTACAACTTTATTTGCCCGCGAGCTGAGTCCATCGTCCATCAGGTC
GTGCGGAGTCGATTCCAAGCCGACCAATCCATCACGGCTGCCTTGCTCCGCATGCATTTCCACGAATGTTTCGTTAGA
GGTTGTGACGCATCCATACTCATAGACTCTACCGACAGCAAT
CCGTTGAAGAAATCCGCCGCCCCGAACCTAACTGTGCGAGGCTTCGAAATCATTGACGAAGCCAAGAAGAACATTGAAGCCTCATGCCCTTCGATGGTCTCCTGTGCCGACATCGCAACT
TTGGCAANNACACGGTACGCGGTCTTCTTGGCAGGAGGGCCTAGCTATGATGTCGCGACGGGAAGGCGAGATGGCATCATCTCGGCCCGCGACGAAGTTAACTTGCCAGGACCGACATTC
TCGCAGCAAAAGGATTCACTCTTGCCGAAATGGTCATTCTCTTGGGTGGACACACCATTGGAATCGCTCACTACTAGACCATATCTCAGATTTATGANNGGTACCGGCGCTCCGGACCGA
TCCATGGACCCAAGCTTGATCATGAAGCTCAAGGTCACCTGTGGCGCTTCATCAAGTAGCGACCCGACCGTGTCCTTGGACCAGAGCACGCCGTCATCGTCGATAACAAGTTCTATAGCG
AGATTCTTGCGAAGAGAGGGATATTGCAAATTGATCAGGAGCTCACTGTTGATAAATCGACCACGGCAATCGTCGCTAAGTACGGGTTGGACGCAAAATGGATTTAGGCTGAGTTTTGCA
ATCGCGATGGTGAAGATGAGCAATGTCGGAGTTCTAACAGGAAATGCTGGATAGATTGGGAAAAACTGTAGGGTTTTCCAACTAGCTAGAATGCTCCGCCAGTT

Retrieve as FASTA