Entry information : EcamPrx156 (EcC050938.20)
Entry ID 10296
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx156 (EcC050938.20)
Name (synonym) EcamPrx156 (EcC050938.20)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx156
start..stop
S start..stop
EgrPrx156 663 0 1..326 1..326
EglPrx156 663 0 1..326 1..326
EguPrx156 659 0 1..326 1..326
VvPrx65 519 0 7..326 7..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..213 213 N° 2 1322..1513 192 N° 3 1630..2205 576  
join(1..213,1322..1513,1630..2205)


exon

Literature and cross-references EcamPrx156 (EcC050938.20)
Protein sequence: EcamPrx156 (EcC050938.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (302)
PWM (Da):   %s   34753.29 (32243.9) Transmb domain:   %s   i5-22o
PI (pH):   %s   5.11 (4.79) Peptide Signal:   %s   cut: 25 range:25-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARKLGLWLVVVFAVAATAEVGRAQLTEGFYGQTCPNVESIVKQAVTTKFGQTFVTIPGTLRLFFHDCFIEGCDASILISSPNGDAEKDAADNQSLAGDGFDTVIKAKQAVEASCQGVVSCADILAIAARDVVVLAGGPSFNVELGRRDGLISKASQVAGKLPEPNFDLDQLNAIFSQHGLTQSDMIALSGAHTLGFSHCNRFANRLYSFSSSSPVDPTLNSTYAVQLMQECPQNVDPQIAINMDPVTPRTFDNMYYTNLVQGKGLFTSDETLFTDSASKPTVLNFANSPGSFNQAFATAMRKLGRVGIKTGSQGEIRRDCTAFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGTGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCGTCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GTGATTCCCTTTTCCTCCATGCATGCA
TTTCCGATCATGCTGCCTCCTCCTCCTTTTTCAGTTTCATCTGATTAATCACACATGTGTAACCCTGGCAAGTAATAGCCTTTCGATCACAGTTCCAAAAGCCCTGAATCAATTGCTAAT
CCATTCGATGAACTCTCATTTCCACAATCTTTCGGATATTCGTCCAGTCTCACACCGTAATATTTTCTTTTTCGGTATATCTTCATGAATATTTTTCTTTAAGTAAAAAGGGAATTAGAA
TGTACATGGATTATCGTTACTTCTTCCACAATGTTACCCAAGTTTTTTAGACGGTCAAAATTGCCGCTCGTTCTTTGCTTGAGCTGAGCCGGAGTTTGAACATCTGGCGAGGTTCTATCC
TAACATCGTACAAATTATATCAATTATATAGAGGAATCATAAGGAACAAGAAGTTGACTTTGGAACACATGTTTTACGTTTTCAATCATTTCATGGACAAAATGAGACGTTTTCATCTAC
CCCAATACTTTCCCGACCAAAAAAAAAAAAAAAAAAAACTGCCCCAATATTTTAACGAGCTTTCTCACAGAGCCCCAACCACGCCTTTTGAATTAATTAATCGCAATTTGTCGAAATTAA
TTGTGACAACAATTTAATTAAGGGAATCAAAAGCATTCCAAGTGAAATTGCCAAACAGAGATATTTTTCCAGGGGGCAGGTAACTAGGTAAGTACATAACTAGCTGCACAAGACGACACA
AGAACAATTGAAAGTTTATGAAATTGAATCACATGGATCAACAATCGCGTTCAGATTCACTCGTTATTAAGTCTTGGCACATGAACAAAACTCTCATATATTCGAGTTAGCACTGACCCT
TAAATGGGCATCATTGTGTTGATTTTCCTTATCTTGGACTTAATTGTGTGATGATTCATCGGGCTTGGTCATGCATTCCTTAAATCTATTCAGCGAACTCGCTTTCCAGGGTCCGATCTT
GTTCATAAAATATGTCCTGGGAGGTATGAATTAGTTCAGGATTACTTTAGATGAGAAACGCCTGATATGAATTTTCATTCAATCACGGTTTCGGCTAGTTAATTTCGATGTTGTTTTTAA
GGGATGCGATGCTTCGATTTTGATCTCGTCGCCTAACGGGGATGCTGAGAAAGACGCTGCGGATAATCAGTCTCTAGCCGGAGACGGGTTCGACACTGTTATCAAAGCGAAGCAAGCTGT
TGAAGCGAGTTGCCAGGGCGTCGTGTCATGCGCGGACATCCTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GTAAGCAAGAACCTCGGTGGACAGTTCACCCTCGCAGCTCAATGTCG
AGTCAAATGACTGTCATGCTCCAAGTCTTAACGTTTTCTCACTCGTTCAATGTGCATGAAAAATCTCAGGCCGGAGGTCCATCGTTCAACGTCGAGCTTGGCCGTCGCGACGGTCTCATC
TCCAAAGCATCTCAAGTAGCCGGGAAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAATGCGATTTTCTCCCAACACGGCCTCACGCAATCTGACATGATCGCCCTCTCGGGCGCT
CACACCCTCGGCTTCTCCCACTGCAACCGATTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCGACCTACGCTGTGCAGCTGATGCAAGAATGC
CCCCAGAATGTGGACCCGCAAATAGCAATCAACATGGACCCCGTGACTCCGCGGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTGTTCACTTCGGACGAGACG
CTCTTCACCGATTCAGCGTCCAAGCCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCAGGCCTTCGCCACCGCGATGAGGAAGCTCGGGAGGGTGGGCATCAAGACCGGA
AGCCAAGGAGAGATACGAAGAGATTGTACAGCTTTCAATTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAGGAAACTAGGACTTTGGTTGGTGGTGGTTTTTGCGGTGGCGGCCACGGCGGAGGTGGGAAGAGCGCAACTGACGGAGGGTTTCTATGGCCAGACCTGCCCAAACGTCGAGAGC
ATCGTGAAGCAGGCGGTAACGACCAAGTTCGGCCAGACCTTCGTCACCATCCCCGGCACGCTCCGCCTCTTCTTCCACGATTGCTTCATCGAG
GGATGCGATGCTTCGATTTTGATCTCG
TCGCCTAACGGGGATGCTGAGAAAGACGCTGCGGATAATCAGTCTCTAGCCGGAGACGGGTTCGACACTGTTATCAAAGCGAAGCAAGCTGTTGAAGCGAGTTGCCAGGGCGTCGTGTCA
TGCGCGGACATCCTAGCCATAGCTGCTCGAGACGTAGTTGTCCTG
GCCGGAGGTCCATCGTTCAACGTCGAGCTTGGCCGTCGCGACGGTCTCATCTCCAAAGCATCTCAAGTAGCCGGG
AAGTTACCGGAACCGAACTTCGATCTCGACCAGCTCAATGCGATTTTCTCCCAACACGGCCTCACGCAATCTGACATGATCGCCCTCTCGGGCGCTCACACCCTCGGCTTCTCCCACTGC
AACCGATTCGCCAACCGTCTCTACTCGTTCTCCTCATCATCTCCGGTGGACCCGACTCTCAACTCGACCTACGCTGTGCAGCTGATGCAAGAATGCCCCCAGAATGTGGACCCGCAAATA
GCAATCAACATGGACCCCGTGACTCCGCGGACGTTCGACAACATGTACTACACGAATCTGGTCCAAGGCAAGGGCCTGTTCACTTCGGACGAGACGCTCTTCACCGATTCAGCGTCCAAG
CCTACCGTGCTGAACTTCGCTAACAGCCCAGGCAGCTTCAACCAGGCCTTCGCCACCGCGATGAGGAAGCTCGGGAGGGTGGGCATCAAGACCGGAAGCCAAGGAGAGATACGAAGAGAT
TGTACAGCTTTCAATTCATGA

Retrieve as FASTA