Entry information : EcamPrx129-2 (EcC051620.20)
Entry ID 10300
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-20 (Qiang Li)
Peroxidase information: EcamPrx129-2 (EcC051620.20)
Name (synonym) EcamPrx129-2 (EcC051620.20)
Class Class III peroxidase    [Orthogroup: Prx067]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx129-2
start..stop
S start..stop
EcamPrx130 659 0 1..323 1..323
EglPrx130 656 0 1..323 1..323
EgrPrx130 656 0 1..323 1..323
EgrPrx129 654 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..75 75 N° 2 191..325 135 N° 3 1179..1940 762  
join(1..75,191..325,1179..1940)


exon

Literature and cross-references EcamPrx129-2 (EcC051620.20)
Protein sequence: EcamPrx129-2 (EcC051620.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (301)
PWM (Da):   %s   34638.47 (32385.3) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.62 (8.72) Peptide Signal:   %s   cut: 23 range:23-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAYLSFVLVICLISPAISGPIKVGFYQKKCPSAEAMVRESVQKALAADPGAVAPLIRLHFHDCFVRGCDGSILLNSTKGNTAEKDSMGNLGIGGFEVIDDAKAKIEAQCPNTVSCADIVAFAARDGVRAAGGFHYAVPSGRRDGRVSLASEVIKNLPGAFFDAAQLEANFAKKGLSLRDMVTLSGAHSIGDSHCSQFTKRLYSFNSTYSQDPSLNPNYAHLLKTKCPRNGPTDPTVPFDPMTPNVLDNAYYHNLKSDKGLLYSDQVLWDAPLTRGLVKDNANHPSAWARRFTAAMVRMGSIEVLTGTQGEIRKNCRVIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa (5' end is missing which has been completed manully).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCGATTTCATTTTCTCTTATGCTAGCAGTTTCAACACGTGCGTTTGAGTTG
ATATATTGTTCATTTTCTTGTCTTGGTCATAACTTTTTGTTTTTGGTTGGGTGCAATTTCAGGTCCATTGAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCTATGGTGAG
AGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGG
GTAATTTTCTAACTCAAGCATTTTATGTGCAACAT
CATTACAAGTGTGATTGGTTTAGCAATTACAAAACTTCTTGGACAAATGCAAATACTGTTTGGCAAAATTTTTTGGGCACTTTGAGGAGATGCAATTTGCACCTTCAAAGCTCTTTAAAG
GCATTTAACGCAAATTAAGTTTGGAGATACTTTAAAATGTTACGTTTCCAAAATTCAAATAGACATTTTTCCTTCCAACTTTACCATCGCTCAACTTTCATAATCCCGAAAATGTTCTTG
AAAGCCCTAATTTTTGCCTTAGCCACCAACGAGCAACCGGCGTGCCATCGATGAGTAGTTGGTGAGCCACTACCACTCTCAATGGTGGTGACTGAGTTCCACCGACAAATAATTTGAGAT
TTTTTTATAAAAAAAAAAATAGCAAAAACCATTTACAAAGTATAATTTGTACCATATAGTATTTCTATTTAAATTTCTTTTCAACGTGTTTTTAAAATACACTTTACCAAACAATACTTG
TATTTTGAAAAGTCCTTTTAACCCAAAGGTCTTTGCATTTTTACAAAAAACATTTCTAAAAAATCGAACTAAACACTCCTTTTAAGTATTCTCTTGCAATGTCTATTATATTTGCATATT
GATCCACTTTTTTCGCAAAACCATACATGGGCCAGCTTTCATATAATGGTTGAATAACTAATCCTAGGAACTTAGAAGTCGGGTTTGCATGATTGATGTCACAAACTCTAAATGGATATC
TAAATAAAGCTGTCATAGATGTTCCTATATCTAATTATAAATAGTCATGTAAAAAATGGATATTTCTATGGTGTGACGTACGTTCTTCTAGTACTCAGGGTTGCGACGGGTCCATTCTTC
TGAACTCGACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCT
CATGTGCCGACATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCA
AAAACCTCCCCGGCGCATTTTTTGATGCTGCACAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATT
GCTCCCAATTCACGAAGCGACTCTACTCCTTCAACTCGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACC
CAACCGTACCATTCGACCCCATGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTGAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGCCATTGACAA
GGGGGTTAGTGAAGGACAATGCGAACCACCCGAGCGCTTGGGCTCGGAGGTTCACAGCAGCGATGGTGCGCATGGGTTCGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGA
ATTGCAGGGTGATAAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAGCTCGAGCGCTTACTTGAGCTTTGTTTTGGTGATCTGTTTAATTTCACCTGCAATTTCAGGTCCGATTAAGGTTGGGTTTTATCAGAAGAAATGCCCATCTGCTGAGGCTATG
GTGAGAGAGTCAGTACAGAAGGCTCTAGCTGCTGACCCTGGAGCTGTTGCTCCGCTCATTAGGCTCCATTTCCATGACTGTTTTGTCAGG
GGTTGCGACGGGTCCATTCTTCTGAACTCG
ACCAAAGGGAACACCGCGGAGAAAGATAGCATGGGAAACCTCGGCATCGGGGGCTTTGAGGTGATCGACGATGCCAAGGCCAAGATTGAAGCCCAATGCCCTAACACCGTCTCATGTGCC
GACATTGTGGCCTTCGCCGCTCGCGATGGTGTTCGAGCTGCCGGAGGCTTTCACTATGCCGTCCCTAGCGGGAGGCGGGATGGGAGAGTCTCGCTCGCGTCGGAGGTGATCAAAAACCTC
CCCGGCGCATTTTTTGATGCTGCACAACTCGAAGCGAACTTTGCGAAGAAAGGGCTTTCGCTCCGAGACATGGTGACTCTCTCCGGAGCTCACTCCATCGGGGACTCTCATTGCTCCCAA
TTCACGAAGCGACTCTACTCCTTCAACTCGACGTATTCACAAGATCCTTCCCTTAATCCTAATTATGCCCATCTTTTGAAGACCAAGTGCCCGCGAAACGGCCCCACCGACCCAACCGTA
CCATTCGACCCCATGACGCCGAACGTACTCGATAATGCTTACTACCACAACTTGAAGAGTGACAAGGGATTGTTGTATTCGGACCAAGTGCTGTGGGATGCGCCATTGACAAGGGGGTTA
GTGAAGGACAATGCGAACCACCCGAGCGCTTGGGCTCGGAGGTTCACAGCAGCGATGGTGCGCATGGGTTCGATCGAGGTGCTCACTGGCACGCAAGGCGAAATTAGGAAGAATTGCAGG
GTGATAAATTAA

Retrieve as FASTA