Entry information : EcamPrx120 (EcC052607.20)
Entry ID 10303
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx120 (EcC052607.20)
Name (synonym) EcamPrx120 (EcC052607.20)
Class Class III peroxidase    [Orthogroup: Prx188]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx120
start..stop
S start..stop
EglPrx120 687 0 1..335 1..335
EgrPrx120 687 0 1..335 1..335
EguPrx120 640 0 1..335 1..335
EglPrx118 454 6e-162 10..335 12..339
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..240 240 N° 2 1442..2209 768  
join(1..240,1442..2209)


exon

Literature and cross-references EcamPrx120 (EcC052607.20)
Protein sequence: EcamPrx120 (EcC052607.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (314)
PWM (Da):   %s   36407.52 (34282.4) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.26 (9.26) Peptide Signal:   %s   cut: 22 range:22-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASIQALVASFFLVFAVSATALPKQVYPLSSPSSLRVGFYKYTCPPAEAIVRATLYEAFSSDPGLAADFLRMYFHDCFVRGCDASILLNSTKGNTAEKDSPVNNPSLEGFDVIDQAKARLEAACPRTVSCADIIAFAARDSVFKAGRIYYDVPSGRRDGRVSRASEVIQNLPPPTFTVPQLIANFARKGFSMDEMVTLSGAHSIGSSHCSSFSNRLYSFNATHKQDPLLDPKYAAFLKTKCPQGNSKTDPKVALDSITPNTLDNKYYQQLLTYRGLFSSDEALYTSKLTKGMVLNNAKYGRVWGPKFVKAMVKLGSLDVLTGQQGEIRKVCGAVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTAAGCAGGTGTACCCGTTATCTTCGCCGTCGTCCCTCCGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GTAATATGCTCTATATGAACATCAAATGAAGGATTTTGCGCTTATTCGTCATTCATTTTCTTGATTTTCCAATAATGTGTTGATGCAGACTCAAATATCAGTTAAAATACAAAGTTGCCA
TGTTAACACCAACACCAAGATACTCTAGAGATGATATGGTACCTTAAATGGGAAAATTACCAAAAAAGTTTTAACCTATTGTAATGTGCTAATACAGTCTTAATTTTTTTTTTCTTTTGC
CAATTCAATCTTGACGTGGACAATTTTAATAATATTTTAATTTTTTCGAATTTCTTAATAATTTTTTTTTCTTTTTTTTTTTCCTCTTCTTCCCCCTTTTTCATTTTTTTCCCTATAGTG
GCCAGCAAGGCTCTGGTGATGGTCATGGCCCCCGCTTGGCCCTGCTAGGTCTAGGCAAGGCCTAGGGCTATAGGCAAGGTAGCTTTGCCCAAATCTAGGTGAGACCAACATCACCATGTC
CTTCCTAGCCATGGGTGAAGGTGGCCTTGCCCACATCTAGGTGAAGCTGCCTCACTCATAGGCCCCAGGCCTCTCCCAAACTTGGGCGAGGCCGAGAGAGGGTTGCGACTTTCTCCGACA
GTCGACAAGTGCTTCATAGCCCTCCTCGTGGGGGAAAAAAGGAAAAAAAAAAGGAAAAAAGAGGAAAAATATATATATTATTCGAAATTGTCCACGTCAGCACCTATTAGCCAAAATTGG
ACGGATTGACTTAATTGACACAATTGCAAAATGTTTAGGATTGAATTGAAAAAAAAAAAAAAGATTTAAAACTAAATTGGCACAATTACAATAGACTTAAAAAAATTTTGGTGATTCTCC
CCACCCTAAACCTATGAAATGCATCAAAACATATGTATTTTTAATTTTGTGTATGTAAAATTGCACCTTTCCCCGGTTGCTATTTCTTACAGTGGAATGGATATAAAGAATGATTTCTCA
ATGCACATGCCGAGGCAGCAACTCATCACTAAGTTGTGCTTTGGCTGCATACCTTCCTTACTTTAGCAAAGCTAGGTTTACGAAGATCAGTATACAAAATTCGTATATTGTGCCAGAAAG
TAGAAGGATTCCATAAGTGAAAATTGAAACAAGCGGGTAATAATCATATCTAATTTGAGTCTATCACATCATCTAGTATATCATATTATCTGATTTGTTAGCTCTTCCCCATTGATTTTA
GGGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAAGGTTTCGATGTCATCGACCAAGCGAAAGCCCGGCT
AGAAGCCGCATGCCCGCGAACTGTCTCGTGCGCCGACATCATCGCATTTGCGGCCCGAGACAGCGTCTTCAAGGCTGGCCGTATCTACTACGATGTCCCCTCGGGCCGTCGTGATGGTCG
CGTCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACTGTGCCGCAACTCATTGCCAACTTCGCGAGAAAAGGGTTCTCAATGGACGAGATGGTGACCCTCTCGGG
AGCACACTCCATCGGCAGCTCTCACTGCTCGTCCTTCTCGAACCGTCTGTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTGTTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAA
GTGCCCCCAGGGCAATTCCAAGACGGACCCGAAGGTGGCGCTCGACAGCATCACGCCAAACACTCTGGACAACAAGTACTACCAACAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGA
TGAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGTCGCGTGTGGGGGCCTAAGTTCGTGAAGGCAATGGTGAAGCTGGGCTCGCTCGACGTGCT
CACTGGTCAACAGGGCGAAATTAGGAAAGTTTGCGGCGCCGTGAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCATTCAAGCCCTGGTCGCTTCCTTCTTCCTAGTTTTTGCTGTATCTGCAACAGCTCTCCCTAAGCAGGTGTACCCGTTATCTTCGCCGTCGTCCCTCCGCGTCGGATTCTAC
AAATATACATGCCCTCCTGCCGAAGCCATCGTCAGAGCCACTCTTTATGAGGCCTTTTCCAGTGATCCGGGGTTGGCTGCTGATTTCCTCCGGATGTATTTCCACGACTGCTTCGTGAGG
GGCTGTGATGCATCCATCCTCCTAAATTCAACCAAGGGAAACACTGCCGAAAAAGATAGCCCCGTGAACAACCCTAGTTTAGAAGGTTTCGATGTCATCGACCAAGCGAAAGCCCGGCTA
GAAGCCGCATGCCCGCGAACTGTCTCGTGCGCCGACATCATCGCATTTGCGGCCCGAGACAGCGTCTTCAAGGCTGGCCGTATCTACTACGATGTCCCCTCGGGCCGTCGTGATGGTCGC
GTCTCCCGCGCCTCCGAGGTGATCCAGAACCTCCCTCCCCCGACCTTCACTGTGCCGCAACTCATTGCCAACTTCGCGAGAAAAGGGTTCTCAATGGACGAGATGGTGACCCTCTCGGGA
GCACACTCCATCGGCAGCTCTCACTGCTCGTCCTTCTCGAACCGTCTGTACTCGTTCAACGCGACGCACAAGCAAGACCCGTTGTTGGACCCTAAGTACGCGGCCTTCTTGAAGACCAAG
TGCCCCCAGGGCAATTCCAAGACGGACCCGAAGGTGGCGCTCGACAGCATCACGCCAAACACTCTGGACAACAAGTACTACCAACAGCTACTGACTTACCGTGGGTTGTTCTCTTCCGAT
GAGGCGCTGTACACTAGCAAGTTGACGAAAGGGATGGTGTTGAACAACGCAAAATACGGTCGCGTGTGGGGGCCTAAGTTCGTGAAGGCAATGGTGAAGCTGGGCTCGCTCGACGTGCTC
ACTGGTCAACAGGGCGAAATTAGGAAAGTTTGCGGCGCCGTGAATTGA

Retrieve as FASTA