Entry information : EcamPrx69 ( EcC053854.30)
Entry ID 10306
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-01-22 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-22 (Achraf Jemmat)
Peroxidase information: EcamPrx69 ( EcC053854.30)
Name (synonym) EcamPrx69 ( EcC053854.30)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx69
start..stop
S start..stop
EgrPrx69 689 0 1..354 1..351
EguPrx69 669 0 1..354 1..351
EglPrx69 635 0 25..354 1..327
EgrPrx83 578 0 25..354 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..297 297 N° 2 619..813 195 N° 3 1052..1217 166 N° 4 1664..2070 407
join(1..297,619..813,1052..1217,1664..2070)


exon

Literature and cross-references EcamPrx69 ( EcC053854.30)
Protein sequence: EcamPrx69 ( EcC053854.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354
PWM (Da):   %s   38311.72  
PI (pH):   %s   8.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSVERLQPITKIKRQQSRSSWHKAMACPKLILSCLLLQLMFSFLVLKVAHGQGLEVGFYQKACPNAEAIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTNQSEKDAPQNHNLRGFQTIDRVKTALEKACPGIVSCVSCADILALVARDVVVATGGLFYDVEIGRRDGCVSILGEASNDLIPSAANIATLKADFAKRGLSVKDLVVLSGGHTIGTSHCTAFSNRLYNFTGKGDTDPTLDSNYVARLKLSCKPNDQTTLVEMDPGSVRTFDIKYFDLIAKRRGLFTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGQIGVLTETSGEVRKVCSKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Incorrect prediction from kazusa due to frame shift in the exon 3.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGTGGAACGTCTACAGCCAATCACTAAGATTAAGAGACAGCAATCACGTTCTTCTTGGCACAAAGCAATGGCTTGTCCGAAGCTCATCTTGTCTTGCTTGTTGCTTCAGTTGATG
TTCTCGTTTCTTGTTCTTAAGGTCGCTCACGGTCAAGGTCTCGAAGTAGGGTTTTACCAGAAGGCATGCCCAAATGCAGAGGCAATCGTGAAGGAAGTCATCGGCCAAGTCATGTCCGTC
GCTCCGAGTCTCTCCGGCCCTCTCTTGAGGCTGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCAAGCTCACATGCTTCTCTTCCTNNNNNNNNNNNNNNNNNNNNGGGCTTT
CATCTGAAGGGTAAATGCATAGTAGGGATGCATAGAGATTCACAAAATTGAATTACCGGATAACAATTTGATAAAATGAAAAATGTGTATTCTTCTTTTCTTGGTAAAGGTAATGAAAAA
TGTGTATTCGATCTAGTAATATCCTAATAAATGTTATTTGGCTCTCATCATCCTTCTCTTGATTCGTCTTTGGTTACGAACTGTTGTCTTCATGGACTCGTGGTTGAATAAAATGCTTTG
TTCTGGGCTTTTCCACAGGGTTGTGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAATCCGAGAAGGATGCCCCTCAGAATCACAACCTTCGAGGTTTCCAAACGATAGATAGAGTC
AAAACGGCATTGGAGAAGGCATGCCCCGGCATCGTTTCGTGCGTTTCGTGCGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
GTGCGTGCATATTCATACATCACATCC
TCTGTATTTTATTCTCAAATTTGAATCTTTGTTACATAAGTACGACGTTAGTAGAATTCTCAATTTTTGCAAACAATCTGTGTTATCTCCTGGGGAAAACAAATATTAGCCACACGTATA
ATAGAGGATAAGCACCGACAATTTTTGTTAATGAGACACGCATTTTTATATAGAATTTGGGTTTTTTTTTTCTTTTTTGTTGTCACTTTAGACTGGAGGACTTTTCTATGACGTGGAAAT
CGGACGAAGAGATGGGTGTGTTTCTATTTTGGGGGAGGCATCTAACGATTTAATACCGTCTGCAGCCAACATTGCTACTCTGAAAGCAGATTTTGCAAAGAGAGGCCTCAGCGTGAAGGA
CCTTGTTGTCTTATCAG
GTAACGCCTAATCTCCAATTACTGCTTCACATGCTTTGTAAAATATTTTGGGGAAATTTTCGAAAAGATGTGCCAATGTCCGTACTTAGCTTAGGCAACACAG
GTCAAGCTTAGCCATCTTCCCTTTCATTCTTCAGGTGGTCTGTAATTTTCCATGCACTCAGGCAAAATGAAACGAAGTTACTTATGCAATTTTTTTTTTTTTTTGATAACCTCAAACCAA
TTTGGGCTAGGCCGTAGCGATCTCTAAACCCACGAATGAAAGCTCAAGAGGTGGAAGGTATTCCTTTGATCGGGGTACAATCTCTAAAAAGAGATAAGACATAAATTAATCGGGAAAAAA
AACTGTAATTTGAGCACGAGATACATAAACACAGTCACCAATACAGGGAGAAAACGTAATTTGTAACGGTGGATCATGCTAATTCTGATTTGCTATTGAGTAGGTGGGCACACCATTGGA
ACATCACACTGCACTGCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACTGACCCCACGCTCGACTCCAATTACGTAGCAAGATTGAAGCTCAGTTGCAAGCCGAATGAC
CAAACCACTCTCGTCGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAGTACTTCGATCTCATCGCAAAGAGAAGAGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGC
CAAACCAAGGCATACCTTGACTTCCAAATCAAGACCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCAATGGTGAAAATGGGTCAGATTGGCGTGCTCACCGAAACGTCTGGTGAA
GTCAGGAAAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCGTGGAACGTCTACAGCCAATCACTAAGATTAAGAGACAGCAATCACGTTCTTCTTGGCACAAAGCAATGGCTTGTCCGAAGCTCATCTTGTCTTGCTTGTTGCTTCAGTTGATG
TTCTCGTTTCTTGTTCTTAAGGTCGCTCACGGTCAAGGTCTCGAAGTAGGGTTTTACCAGAAGGCATGCCCAAATGCAGAGGCAATCGTGAAGGAAGTCATCGGCCAAGTCATGTCCGTC
GCTCCGAGTCTCTCCGGCCCTCTCTTGAGGCTGCATTTTCATGATTGTTTCGTTAGG
GGTTGTGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAATCCGAGAAGGATGCCCCTCAG
AATCACAACCTTCGAGGTTTCCAAACGATAGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCCGGCATCGTTTCGTGCGTTTCGTGCGCTGACATCTTGGCCCTTGTCGCTAGAGAC
GTTGTCGTCGCG
ACTGGAGGACTTTTCTATGACGTGGAAATCGGACGAAGAGATGGGTGTGTTTCTATTTTGGGGGAGGCATCTAACGATTTAATACCGTCTGCAGCCAACATTGCTACT
CTGAAAGCAGATTTTGCAAAGAGAGGCCTCAGCGTGAAGGACCTTGTTGTCTTATCAG
GTGGGCACACCATTGGAACATCACACTGCACTGCCTTCTCCAACCGCCTCTACAACTTCACC
GGAAAGGGCGACACTGACCCCACGCTCGACTCCAATTACGTAGCAAGATTGAAGCTCAGTTGCAAGCCGAATGACCAAACCACTCTCGTCGAGATGGACCCAGGAAGCGTGAGGACGTTC
GACATCAAGTACTTCGATCTCATCGCAAAGAGAAGAGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACCAAGGCATACCTTGACTTCCAAATCAAGACCGGTGGATCC
ACTTTCTTCAAGGACTTTGGAGAGTCAATGGTGAAAATGGGTCAGATTGGCGTGCTCACCGAAACGTCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA