Entry information : EcamPrx84 (EcC053919.10)
Entry ID 10307
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx84 (EcC053919.10)
Name (synonym) EcamPrx84 (EcC053919.10)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx84
start..stop
S start..stop
EguPrx88 667 0 1..327 1..327
EguPrx84 667 0 1..327 1..327
EgrPrx84 667 0 1..327 1..327
EgrPrx82 652 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 452..637 186 N° 3 910..1075 166 N° 4 1254..1660 407
join(1..225,452..637,910..1075,1254..1660)


exon

Literature and cross-references EcamPrx84 (EcC053919.10)
Protein sequence: EcamPrx84 (EcC053919.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35304.09 (32289.5)  
PI (pH):   %s   8.26 (8.38) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLQLMFLFLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVMDQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTHQAEKDAPPNFSLRGYQVIDRVKTALEKACPGTVSCADVLAIVARDVVVATGALSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSDRLYNFTGKGDTDPKLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDAALLDDSETKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATGGATCAAGTCATGTCCGTTGCACCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGACTGTTTCGTCAGG
GTAAGTGAATGAATG
AGCGCACGTACTTCTCTTCCTACTCGTGCTTGGGAAGAGTACTATCTTATGAGCACCTGTATAATGACTGAAAAGAATGGTTTTTACTTTCATCGAACCATCTGCTAAACATCAATTAGA
ACAAGTTATAATCTAGATTCATCCGTGGATACGAACTGTTTTCTGCATGAACTCACAGTCGAATAGTGTTTCTTTCTGGGTTTTTCCACAGGGTTGCGAAGGTTCAATACTCTTGAACTC
TTCGACCCATCAAGCCGAGAAGGATGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCACCGTTTCGTGTGCTGA
CGTCTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
GTGCGCATATGCATATGTCACTTGCATTATTTATTCATTCTAATTTTAATGTTCCTCATTTACATATGACATCAGTAGAAATC
TCGATTTTCGCAAACAATCCATCCCCTCTCATTGGAAAAAAAATTCCGCCCATACATATCTTCGGATCTAATTACTGCTTGTCAAAACCAAGATTATTTTCGCATCGTGCATCATGAAAC
TCAATGATTTTTCCATAAGAGAAAAACATATTTATATAGGAATTGGGTTTCTTTTTGTTGTCACTTTAGACCGGAGCACTTTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTC
TCTAGTTTAAACGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAGAGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTAAC
ACTTAATCTTCAATCATTGCTTCATATGCTTTATCGATTATTTTGTGGAAATTGACATAGATTAATAGGAAGAAACTATAATTTGAGCAGGAGATTCATAAACAGTCTGCACTGCGAGGA
GAAAACGTAATTTGTAAAGTCAGATCATGCTAATTCTGATTTCTGTTGACCAGGTGGCCACACCCTTGGAACTTCACACTGCTCTTCCTTCTCCGACCGCCTCTACAACTTCACCGGAAA
GGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTGAAGCTCAAGTGCAAGCCAAATGACCAAACCACCCTCGTTGAGATGGACCCAGGAAGCGTGAGGACTTTTGACAT
CAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCGAAACCAAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTT
CTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTTCTCACCGGAACGGCTGGTGAAGTCAGGAAAGTGTGTGCAAAGGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATGGATCAAGTCATGTCCGTTGCACCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGACTGTTTCGTCAGG
GGTTGCGAAGGTTCA
ATACTCTTGAACTCTTCGACCCATCAAGCCGAGAAGGATGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCACC
GTTTCGTGTGCTGACGTCTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
ACCGGAGCACTTTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAACGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAGAGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGACTGAAGCTCAAGTGCAAGCCAAATGACCAAACC
ACCCTCGTTGAGATGGACCCAGGAAGCGTGAGGACTTTTGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCGAAACC
AAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTTCTCACCGGAACGGCTGGTGAAGTCAGG
AAAGTGTGTGCAAAGGTTAACTAA

Retrieve as FASTA