Entry information : EcamPrx82 (EcC053919.30)
Entry ID 10308
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx82 (EcC053919.30)
Name (synonym) EcamPrx82 (EcC053919.30)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx82
start..stop
S start..stop
EgrPrx82 663 0 1..327 1..327
EgrPrx88 663 0 1..327 1..327
EglPrx82 661 0 1..327 1..327
EguPrx82 647 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19975..20199 225 N° 2 20461..20646 186 N° 3 20919..21084 166 N° 4 21263..21669 407
join(19975..20199,20461..20646,20919..21084,21263..21669)


exon

Literature and cross-references EcamPrx82 (EcC053919.30)
Protein sequence: EcamPrx82 (EcC053919.30)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35255.21 (32240.6)  
PI (pH):   %s   8.69 (8.89) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLQLMFLFLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVIGQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTNQAEKDAPPNLSLRGYQVIDRVKTALEKACPGTVSCADVLAIVARDVVVATRGLSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSDRLYNFTGKGDTDPKLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDAALLDDSQTKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCATGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATCGGTCAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGACTGTTTCGTCAGG
GTAAGTGAATGAATG
AGCGCACGTACTTCTCTTCCTACTTGTGCTTGGGAAGAGTACTATCTTTTGAGCACCTGTATAATGACTGAAAAGAATGGTTTTTACTTTCGTCGAACCGTCTGCTAAACATCAATTAGA
ACAGGTTATAATCTAACGAATGGTGTTTAGCCCCTCAACGTACTTTTCTAGATTCCTCCGTGTATACGAACTGTTTTCTGCATGAACTCACAGTCGAATAGTGTTTCTTTCTGGGTTTTT
CCACAGGGTTGCGAGGGTTCAATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATCTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTG
GAGAAGGCATGTCCCGGCACCGTTTCGTGTGCTGACGTTTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
GTGCGCACATGCATATGTCACTTGCATTATTTATTCATTCTAATTTTA
ATGTTCCTCATTTACATATGACATCAGTAGAAATCTCGATTTTCACAAACAATCTATGATCTCTCATTGGAAAAAATATTCCGCCCATACTTATCTTCGGATCTAATTACTGCTTGTCAA
AACCGAGATTGTTTTTGCGTCGTGCATCAAAAAACTCAATGATTTTTCCATAAGAGAAAAACATATTTATATAGTAATTGGGTTTCTTTTTGTTGTCACTTTAGACCAGAGGACTTTCCT
ATGATGTGGAAACTGGGCGAAGAGATGGCAACGTCTCTAGTTTAAACGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAGAGGCC
TCAGTGTGAAGGACCTTGTCGTTCTATCAG
GTAACACCTAATCTTAAATCATTGCTTCATATGCTTTATCAATTATTTTGTGGAAATTGACATAAATTAATAGGAAGAAACTATAATTTG
AGCAGGAGATTTATAAACAGTCTGCACTGCGAGGAGAAAACGTAATTTGTAAAGTCAGATCATGCTAATTCTGATTTCTATTGACCAGGTGGCCACACCCTTGGAACTTCACACTGCTCT
TCCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCGAGGTTGAAGCTCAAGTGCAAGCCGAATGACCAAACCACCCTTGTC
GAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCCAAACCAAGGCATAC
ATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGAAAAGTGTGT
GCAAAAGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCATGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATCGGTCAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGACTGTTTCGTCAGG
GGTTGCGAGGGTTCA
ATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATCTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCACC
GTTTCGTGTGCTGACGTTTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
ACCAGAGGACTTTCCTATGATGTGGAAACTGGGCGAAGAGATGGCAACGTCTCTAGTTTAAACGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAGAGGCCTCAGTGTGAAGGACCTTGTCGTTCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCGAGGTTGAAGCTCAAGTGCAAGCCGAATGACCAAACC
ACCCTTGTCGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACGCTGCACTTCTTGATGATAGCCAAACC
AAGGCATACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGA
AAAGTGTGTGCAAAAGTTAACTAA

Retrieve as FASTA