Entry information : EcamPrx198 (EcC053919.40)
Entry ID 10309
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-03-26 (Qiang Li)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2013-03-26 (Qiang Li)
Peroxidase information: EcamPrx198 (EcC053919.40)
Name (synonym) EcamPrx198 (EcC053919.40)
Class Class III peroxidase     [Orthogroup: Prx011]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx198
start..stop
S start..stop
EgrPrx83 348 1e-121 1..256 73..327
EgrPrx82 343 2e-119 1..256 73..327
EgrPrx88 343 2e-119 1..256 73..327
EcamPrx82 343 2e-119 1..256 73..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..192 192 N° 2 1694..1849 156 N° 3 1993..2414 422  
join(1..192,1694..1849,1993..2414)


exon

Literature and cross-references EcamPrx198 (EcC053919.40)
Protein sequence: EcamPrx198 (EcC053919.40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   256
PWM (Da):   %s   27977.2  
PI (pH):   %s   8.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FLQGCEDSIQLNSPSNQAEKDAFMNHSLRGCQTIYRVKTVLENACSGIVSCADSLVFVARDDIVWIGGLSYNVEIGRRDGNVSRANEALHNLIPPTANIIILRSGFAKRALSVKDFFLFCPGGHTIGISVCSAFSICLYNFTGKGDADPKLDSNYVTRLKFQCKPNGNTTCIETDLGSARTFDIKYFKLIPxRRGLFTLDVTILDNSQTKAYNDLQTKTSRSAFMKDFGVSMVKKGWIDVLTGMAGEVRKVCSKIN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (5' end is missing). Close to EcS784072.10 (Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCTGCAGGGTTGTGAAGATTCAATACAATTGAACTCTCCGAGCAATCAAGCCGAGAAGGACGCATTCATGAATCATAGCCTTCGAGGTTGCCAAACGATCTATAGAGTCAAAACGGTC
TTGGAAAATGCATGCTCTGGCATCGTCTCATGTGCTGACAGTTTGGTCTTTGTTGCTAGAGACGACATCGTC
GNNNNNNNNNNNNNNNNNNNNGACGGGGATGCTCTGGTTCGCTGGTTT
GCCGGGCGACGAACGGAAAGGAGCGGAAAAGAGAGAACAACGGTGGCGCGGGCTGAGCGACGGCGAGCGGTCGGAGGGGCGGCCGGCAACGAGCGGCGGAGCGGGCGTGCGACGGCGGTG
AACGGCGGAGGCGTGCGGCTTCTCCAGCTTGCTGGTTGCTGGGTTTTTTTGAAGAAGAAGAAGGAGATGAAGAAGATGGAGATGGAGGAGTCGCACGGATGGGAGGAAGAAGAGAGGGAG
GAGAGAGAGAGAGATGGGGGGCTTTTTCTTTTCTTTTTCCTCTTTTCTTTAATCCCCAAAAATGGCCCACCACCATGACATCATGGGTGATGTCATACTCCACTCACTCCCACAACCTCT
TCCCAATGGGTGCACTTTCATTTTCCGCCGGGGTCCAAAACTTTGCGCAACAATTTCTTCAATTTCACTTGATTCTCTTCCAATTGAATCAAATTGACGTCAATAAAATTAATCCAATGT
CACTACACTTCAATTCACATCTTCACTTGTCCGTAGAACCAACTTAAGTCCCAAAAGCACAACCAAAGACGAGCCTACTATTTCTCGAGCCAACTTAACCATTTTCGGATTTAATTTGCC
AAAGAACTCTGATTGCATGAAAAATCTTTCAAAGATAAGTCAATGATCCTAAAATGATTTGTGACACCCCCGGACTCCCAATTTCTGAATTCGATCTCAATTCCACGGTTAATTTCACTT
TGGCACGATATTAGCGCGGCCTAACCTACCGGGTAGCCTTTAGAAATTTTCATGCATTTGACCTGTGGTTGATCATCTCAAGCCACAATGTACATCTTTGAAACATTGGCGACTTTCGGT
TGTCGGGGAAATCTCAAGGTTTCAAATACGAACACAGGGTACCCAATCGATAGAAAAGTCGGTCTAGTGTCGATCGACAAGGATTATGTGATCCGGTGGAATCACCCACACCTGATCACA
TGCCTCTGTCGAGTCGACCTATCTCCGATCTCTAATCAATTTTAAATTGTGCCGTAATGACCCTTGCAGATTAGCTCGGTCGAAAGGTCGCTTCCTAGCCAAATTCTCGAGTCTGATGCA
TTAGAAACTCTTGACAGCTTCACCCGATAGACTAGTTTCCACATGAGTGGCCGACTCAAGGAAAAGAACTATATGCGTGCCAACGAAATGCCCGTATCAATTTATTGAAAATAGAATTGG
AAAAATCGGGATGTCACAGACAGTTTGGTCTTTGTTGCTAGAGACGACATCGTCGCGTTGTGCACATGCTCATGCCAACTATCTGCTTTTAGTTTGAATGTTCATTACATAGATTGTATG
TGAAACCAATAAAAATCTTGAATTCCCAAACGATCTATCGTCTCATCGACAGAGTGCATGATAAAACTCGACAATTTTTCTTTATGAGAAAAACATATTAATATGGAAACTATGTTTTGA
TGTATTGTTACTTTGGATTGGAGGATTGTCCTATAATGTGGAAATCGGACGAAGAGATGGGAACGTTTCTAGAGCGAATGAGGCACTCCACAATTTAATACCACCAACTGCCAACATTAT
AATTCTGAGATCAGGATTTGCAAAGAGAGCCCTCAGCGTTAAGGACTTT
GTCAATTATTTTGTGGATATTGACATGAATCGGTCAGGACCAAACTATATTTTAGGAGTTATGTTACTACT
AAGTGATTGACTAATTTGTAGAGTTAGATCGAGAAAACATGATGTGTAGAGTTAGATCATGCTAATTTTGAGTTCCTATTTTGCCCAGGTGGGCACACCATTGGAATTTCGGTCTGCTCT
GCCTTTTCCATTTGCCTCTACAACTTCACTGGAAAGGGCGACGCCGACCCCAAGCTCGACTCCAACTACGTAACGAGATTGAAGTTCCAGTGCAAGCCAAATGGCAATACCACTTGCATC
GAGACGGACCTGGGAAGCGCTAGGACATTCGACATCAAGTACTTCAAACTCATCCCAATNAGAAGAGGCCTCTTTACTTTGGACGTCACAATTCTTGACAACAGCCAGACCAAAGCGTAC
AATGACCTCCAGACCAAGACCAGCAGATCCGCTTTCATGAAGGACTTTGGAGTGTCGATGGTGAAGAAGGGTTGGATCGACGTGCTCACTGGAATGGCCGGCGAAGTCAGGAAAGTGTGT
TCAAAGATTAATTA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTTCTGCAGGGTTGTGAAGATTCAATACAATTGAACTCTCCGAGCAATCAAGCCGAGAAGGACGCATTCATGAATCATAGCCTTCGAGGTTGCCAAACGATCTATAGAGTCAAAACGGTC
TTGGAAAATGCATGCTCTGGCATCGTCTCATGTGCTGACAGTTTGGTCTTTGTTGCTAGAGACGACATCGTC
TGGATTGGAGGATTGTCCTATAATGTGGAAATCGGACGAAGAGATGGG
AACGTTTCTAGAGCGAATGAGGCACTCCACAATTTAATACCACCAACTGCCAACATTATAATTCTGAGATCAGGATTTGCAAAGAGAGCCCTCAGCGTTAAGGACTTT
TTCCTATTTTGC
CCAGGTGGGCACACCATTGGAATTTCGGTCTGCTCTGCCTTTTCCATTTGCCTCTACAACTTCACTGGAAAGGGCGACGCCGACCCCAAGCTCGACTCCAACTACGTAACGAGATTGAAG
TTCCAGTGCAAGCCAAATGGCAATACCACTTGCATCGAGACGGACCTGGGAAGCGCTAGGACATTCGACATCAAGTACTTCAAACTCATCCCAATNAGAAGAGGCCTCTTTACTTTGGAC
GTCACAATTCTTGACAACAGCCAGACCAAAGCGTACAATGACCTCCAGACCAAGACCAGCAGATCCGCTTTCATGAAGGACTTTGGAGTGTCGATGGTGAAGAAGGGTTGGATCGACGTG
CTCACTGGAATGGCCGGCGAAGTCAGGAAAGTGTGTTCAAAGATTAATTA

Retrieve as FASTA