Entry information : EcamPrx87 (EcC053919.50)
Entry ID 10310
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx87 (EcC053919.50)
Name (synonym) EcamPrx87 (EcC053919.50)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx87
start..stop
S start..stop
EguPrx83 647 0 1..327 1..327
EgrPrx83 639 0 1..327 1..327
EglPrx87 633 0 1..327 1..327
EgrPrx87 632 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..225 225 N° 2 629..814 186 N° 3 1092..1257 166 N° 4 1440..1846 407
join(1..225,629..814,1092..1257,1440..1846)


exon

Literature and cross-references EcamPrx87 (EcC053919.50)
Protein sequence: EcamPrx87 (EcC053919.50)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35054.14 (32093.6)  
PI (pH):   %s   8.55 (8.73) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSKLFLSCLLVQLTFLFLVPEVAHGQGLKVGFYQKACPNAEAIVKGVIREVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTNQAEKNAGPNLSLRGFQTIDRVKRALEKACPGIVSCADILALVARDVVVATGALSYDVETGRRDGNVSILTDALNNLIPPSANITTLKADFAKKGLSVKDLVVLSGGHTIGTSHCSSFSGRLYNFTGKGDADPTLDSNYIARLKLRCKPNDQTTLVEMDPGSVRTFDVKYFDLIPKRRGLFTSDSALLDDSETKAYIDLQVKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCTKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTCTTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AACGCAGAGGCCATCGTGAAGGGGGTCATCCGTGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCG
AGCTCACATGATTCTCGTCCTACCACAAGTGTAACTCGTCCTACTACGAGTGTAAAGTTTACCATTTTCTAATTACGTGATTTTTTGCATGTAACTAATGTTCGGATTCTAAGGTGAAAA
ACTTACTGGCGAAAAACGAGCGTGAGAATTTAGATCTTGGGCTTTCATCTGAAGGGGTAATGCATGGTAGGAATGCATAGAGATTTACAAGATTGATTTACTGGATAACAATATGATAAA
ATGGAAAATGTGTATTAGAACTAGTTGTGTACTAGTAAATGGTGTTTGGCTCCTCAACATACTTCTCTAGATTCGTCCTTGGTTACGAACTACTACTGTCTTCATGAACTCACGGTTGAA
TCATCTTTTGTTCTGGGCCTCTCCACAGGGCTGCGAAGGTTCAGTACTATTGAACTCTCCGACCAATCAAGCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGAT
CGATAGAGTCAAAAGGGCATTGGAGAAGGCATGCCCGGGCATCGTCTCATGTGCTGACATTTTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCG
GTGAGCATATGCATACATTACCTCCT
TTATTTTTTGTTTTAAACTTGGATGTTTGTTATATAATTAGGACGTTAGTAGAAATCTTGATTTCACAAACGATCTGTGTTATCTCATTTGAAAACGAATTCTAGCCATACATATTATGG
GATGCAAGTATCGCTTGTTGATATTAAGATTATTTTTACGGTGCTCTTGACAAAACACGACTATTTTATATTTTAATGAGAAAAACATTCTTATATAGATTTTTTTTTTTTTTTTTGGTG
TTGTCTTTTAGACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCCATCTTGACCGACGCACTTAACAACTTAATACCACCTTCGGCCAACATTACAACTC
TGAAAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGTCCTGTCAG
GTAACACCTAATCTCCAATTATTGCTCCATATGCTTTGTCAATTATTTTATGGGGATTGACAT
AAATTAATCGGGAAGAAATTGTAATTCGAGTGCGAGATTCATAAACATCGTCAGCACTACAACGAGAGAACATAATTTGTGTAATTAGATCATGCTAATTCTGATTTCCAATTGACCAGG
TGGGCACACCATTGGAACTTCACACTGCTCTTCCTTCTCCGGCCGCCTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAG
GTGCAAGCCGAATGATCAAACCACCCTTGTCGAGATGGACCCAGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGC
ACTTCTTGATGACAGCGAAACCAAGGCGTACATTGACCTCCAGGTCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCAC
TGGAACGGCGGGCGAAGTCAGAAAAGTGTGCACAAAGGTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTCTTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AACGCAGAGGCCATCGTGAAGGGGGTCATCCGTGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GGCTGCGAAGGTTCA
GTACTATTGAACTCTCCGACCAATCAAGCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAAGGGCATTGGAGAAGGCATGCCCGGGCATC
GTCTCATGTGCTGACATTTTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCG
ACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCCATCTTGACCGACGCA
CTTAACAACTTAATACCACCTTCGGCCAACATTACAACTCTGAAAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGTCCTGTCAG
GTGGGCACACCATTGGAACTTCA
CACTGCTCTTCCTTCTCCGGCCGCCTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGCAAGCCGAATGATCAAACC
ACCCTTGTCGAGATGGACCCAGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTTCTTGATGACAGCGAAACC
AAGGCGTACATTGACCTCCAGGTCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGAACGGCGGGCGAAGTCAGA
AAAGTGTGCACAAAGGTCAATTAA

Retrieve as FASTA