Entry information : EcamPrx122 ( EcC054062.60)
Entry ID 10311
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-15 (Christophe Dunand)
Peroxidase information: EcamPrx122 ( EcC054062.60)
Name (synonym) EcamPrx122 ( EcC054062.60)
Class Class III peroxidase    [Orthogroup: Prx192]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx122
start..stop
S start..stop
EgrPrx122 613 0 22..337 1..316
EglPrx122 585 0 22..337 1..315
EguPrx122 582 0 22..337 1..309
EgrPrx121 533 0 1..337 1..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..216 216 N° 2 499..1296 798  
join(1..216,499..1296)


exon

Literature and cross-references EcamPrx122 ( EcC054062.60)
Protein sequence: EcamPrx122 ( EcC054062.60)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (314)
PWM (Da):   %s   35989.31 (33727.2)  
PI (pH):   %s   9.06 (9.06) Peptide Signal:   %s   cut: 24 range:24-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASVTAGFHALALSLFVSVSAMAAPPLKVGYYLPTCPLAEKIIKDTVFNAVSRDPGMAAGLVRLHFHDCFVRGCDASVLLKSTPGNPAERDHPANNPSLRGFEIIDQAKARLEALCPGTVSCADIVAFAARDSAQFASRSSALFTGGIIYDVPAGRRDGRVSRLPEVTQNLPPPSFNAQQLIANFARKGLSVDEMVTLSGAHSIGISHCSSFSSRLYAFNATHAQDPTLDPAYATFLKTKCPPPSNKNQPDPTRPLDSITANTLDNNYYIQLLQRRGLLTSDQTLYTSPSTSGLVVNNANYGFTWSRKFAKAMVKMGSIGVLTGNQGEIRKVCSVVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1). No EST. Short extra sequence (SAQFASRSSA) but no splicing prediction.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGTCACGGCGGGGTTTCACGCGCTTGCGTTGTCTCTCTTCGTATCGGTTTCTGCAATGGCAGCTCCCCCGCTAAAGGTGGGATACTACCTCCCTACTTGCCCGTTGGCAGAA
AAAATCATCAAGGATACCGTGTTCAATGCTGTCTCGAGGGACCCCGGGATGGCGGCCGGTCTCGTTCGCCTGCATTTTCACGATTGCTTCGTTAGG
GTACGGTGAAGTATTTATGCTCAA
AATTTTTGCCTTAATCGACTTATTTCACTTTCTTTAAATATTTATTTCTTCTCTTTTCAGTAATTCCCTTTGCTGATTGGAAGGAACATGTTGAAAGTGTGCTAGAGAATTTGCTAGGAC
TCATAAAATATGTATTGGAAATGTAAATTTTTTTTATGAGGCATAAAGTTTCTTTTGTATCGTGTGTGCGCGCGCGTGTATGGTTGATAGTTATTTTGTGATTTCTGTACTCTTACTGAC
TTTCTAGACTTATCTCAGGGCTGTGATGCTTCAGTGCTCTTGAAATCAACCCCAGGAAACCCGGCGGAAAGAGATCACCCCGCTAACAACCCTAGCCTCCGAGGGTTTGAAATCATCGAC
CAAGCCAAGGCCCGGCTCGAAGCCTTGTGCCCTGGAACAGTCTCGTGTGCCGACATCGTGGCCTTTGCTGCCCGTGACAGTGCCCAATTTGCCAGCCGCAGCAGTGCTCTATTCACTGGG
GGCATAATCTACGATGTCCCTGCTGGCCGCCGCGACGGCCGTGTCTCTCGCCTCCCGGAAGTCACACAGAACCTCCCGCCGCCGAGCTTCAACGCCCAGCAGCTCATTGCGAACTTCGCT
AGGAAAGGGCTCTCGGTGGATGAGATGGTGACCCTCTCGGGAGCGCACTCGATCGGAATCTCGCACTGCTCTTCGTTCTCGAGCCGCCTCTACGCGTTCAACGCCACCCACGCCCAAGAT
CCTACCTTGGACCCTGCGTACGCCACTTTCCTGAAGACCAAGTGCCCGCCACCGAGCAACAAGAACCAACCGGACCCAACCAGGCCGCTCGATAGCATCACGGCCAACACTTTAGACAAC
AATTACTACATTCAGTTGCTGCAGCGCCGCGGCTTGTTGACTTCCGACCAGACGCTGTACACGAGTCCCTCGACTTCGGGGCTGGTCGTGAACAACGCGAATTATGGCTTTACTTGGAGC
AGGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGGAGTGCTCACTGGTAATCAAGGAGAGATCAGGAAGGTGTGCAGTGTCGTGAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCGTCACGGCGGGGTTTCACGCGCTTGCGTTGTCTCTCTTCGTATCGGTTTCTGCAATGGCAGCTCCCCCGCTAAAGGTGGGATACTACCTCCCTACTTGCCCGTTGGCAGAA
AAAATCATCAAGGATACCGTGTTCAATGCTGTCTCGAGGGACCCCGGGATGGCGGCCGGTCTCGTTCGCCTGCATTTTCACGATTGCTTCGTTAGG
GGCTGTGATGCTTCAGTGCTCTTG
AAATCAACCCCAGGAAACCCGGCGGAAAGAGATCACCCCGCTAACAACCCTAGCCTCCGAGGGTTTGAAATCATCGACCAAGCCAAGGCCCGGCTCGAAGCCTTGTGCCCTGGAACAGTC
TCGTGTGCCGACATCGTGGCCTTTGCTGCCCGTGACAGTGCCCAATTTGCCAGCCGCAGCAGTGCTCTATTCACTGGGGGCATAATCTACGATGTCCCTGCTGGCCGCCGCGACGGCCGT
GTCTCTCGCCTCCCGGAAGTCACACAGAACCTCCCGCCGCCGAGCTTCAACGCCCAGCAGCTCATTGCGAACTTCGCTAGGAAAGGGCTCTCGGTGGATGAGATGGTGACCCTCTCGGGA
GCGCACTCGATCGGAATCTCGCACTGCTCTTCGTTCTCGAGCCGCCTCTACGCGTTCAACGCCACCCACGCCCAAGATCCTACCTTGGACCCTGCGTACGCCACTTTCCTGAAGACCAAG
TGCCCGCCACCGAGCAACAAGAACCAACCGGACCCAACCAGGCCGCTCGATAGCATCACGGCCAACACTTTAGACAACAATTACTACATTCAGTTGCTGCAGCGCCGCGGCTTGTTGACT
TCCGACCAGACGCTGTACACGAGTCCCTCGACTTCGGGGCTGGTCGTGAACAACGCGAATTATGGCTTTACTTGGAGCAGGAAGTTCGCCAAGGCAATGGTGAAGATGGGCTCGATCGGA
GTGCTCACTGGTAATCAAGGAGAGATCAGGAAGGTGTGCAGTGTCGTGAACTAA

Retrieve as FASTA