Entry information : EcamPrx60 (EcC054231.50)
Entry ID 10314
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx60 (EcC054231.50)
Name (synonym) EcamPrx60 (EcC054231.50)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx60
start..stop
S start..stop
EglPrx60 672 0 1..344 1..344
EgrPrx60 672 0 1..344 1..344
EguPrx60 666 0 1..344 1..344
CroPrx18 526 0 17..339 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..240 240 N° 2 672..863 192 N° 3 1017..1179 163 N° 4 1920..2359 440
join(1..240,672..863,1017..1179,1920..2359)


exon

Literature and cross-references EcamPrx60 (EcC054231.50)
Protein sequence: EcamPrx60 (EcC054231.50)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (313)
PWM (Da):   %s   37383.66 (34004.9)  
PI (pH):   %s   5.96 (5.01) Peptide Signal:   %s   cut: 32 range:32-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSPRSTPRFSKFLALFLLLGFGKTYCASDPPLTLDYYKSSCPSVLEIVRKEMECAVLSDPRNAALIIRLHFHDCFVQGCDGSVLLDDTITLHGEKKAPPSINSLGGFRIVDRIKNMLESECPGVVSCADILTVAARDATLLVGGPYWDVPLGRKDSRTASYELTSAIPTADESLPSIISKFLFQGLSVTDMVALAGAHTVGMARCENFRARIYGDFEATSGASPASKVYLSHLMSVCPPIGGGNNNVAPMDSVTPNLFDNSFYHLLLQGEGLLNSDQEMYSSILAVQTKEIVKKYAADPIAFFQQFSESMVRMGNITNPESFVNGEVRKNCRFINTWAPEI

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCATCGCCACGCTCGACGCCCCGATTTTCCAAATTCCTGGCTCTCTTTCTCTTGTTAGGCTTCGGCAAAACATATTGCGCCAGCGACCCTCCATTGACGTTGGATTACTAC
AAGTCGTCGTGTCCGTCAGTGCTCGAGATTGTCAGGAAGGAGATGGAATGCGCCGTGCTCTCTGACCCTCGCAATGCCGCATTGATCATTCGGTTGCATTTCCACGACTGCTTTGTTCAG
GTTCGTTTTCATTTTGTATGGTAATTTCGCGTAGGCCGGACTAGCCACCTTTGCAAGCTTGCTAAGGTTTGAACTTGGTAGACACAATGGGTATTTCTATATTCGATTTCAAGGGGACCG
ATGTGTCTCTGTGTTCGTAGATATATATACCTGATTCGGCCCAGTGAATGATTAATTTTCAAGAAGGGCTGCCACCAATCTCATTTTTACAGATCAACTTCATTATGTACATGTGAAAAT
GTCTTTCTACTAATTGTGCACTAAGCTGAGAGATTTGAATGTGGGAGACACGATCAATAAGTCTAAAGCTCGAGCTAGTAACCACAATTAGAATAAAATATAGCTAACCAGAGGTTAAAC
TAGCGGATTAGAGCCTGTAAAATCGTGATCGGTCCTTTGTTTTTCCCCTAACAATTGGGATACGAGCATAGGGATGCGACGGGTCGGTTTTGCTAGATGACACTATCACGCTCCACGGAG
AGAAGAAAGCTCCCCCCAGCATAAATTCTCTAGGAGGGTTCAGGATCGTCGACCGCATCAAGAACATGCTTGAATCCGAGTGCCCCGGAGTTGTCTCTTGCGCCGACATACTCACGGTTG
CCGCAAGAGACGCTACGCTTTTG
GTATGTCCGCTAACTTTCGTCTCTTTTCAAGCATAAAAGCATTGATTACTCCATTTCGTCATTCATGTCCTTATGCCATCGCTAGTCGTGGTGTTAA
ACTTAAGACCAAGTTCTAATGCGATGATAAACTGTAATCTTTTGGATTTCGCCAAGGTTGGTGGACCTTATTGGGACGTACCCTTGGGAAGGAAGGACTCGAGGACAGCGAGCTACGAGC
TCACCTCCGCCATCCCGACAGCTGACGAGAGCCTTCCGTCCATCATCTCCAAGTTCCTCTTCCAAGGCCTCTCCGTCACTGACATGGTCGCTCTCGCCG
GTAAATTAACTAAGCTCAAGA
ATGTCCTATCACGCGATCGCTTACGTGCTCTTTAAATAATTTTAATGTCCTATGATTTTGCTAACTTCTCGAGTGTCGGATGAATATGCTGATGGCTACATAATAGATTCCACCTCCAGA
CTGCAGATTGATGTTGTTGTTGAATGCGACTTCGTGTAAAGCTAACTTGACCTAATATTTCCCCCAACCACATGTGCACCCGTCTCTAAAACGTCTTATTCTCCGGTCAAAATCAAATTC
TCAAGGAAAAATATAATGTCCCTTATAAATTGTGATGTATTTCTAAACATTTCATTTAGCCACGCCCACAAAAAAACAGAAATTTCAATTGTACATGACTGTTGAATCTGTTCGGTCCTA
ATTAAGATTCTAGCTTCCTCTGGTAATAAAATATCGAGAAGAATCACGACGAGCGGAAAGGATAAGGCTTTAGCCTCAGGTAGCGTGGACCAATTCAAGATCGAATTTCCATTTTATTAT
CGAAATTTGTACCATCGTACACAAAAGGAGAGGCTAAAAAGCGATGCAAGGTTCATTAATCTGAGTGGAAGAAAAGAAAGATGAGTCATCACGCAACATACGAAAGTGGAGACTTGCGGT
CCACGTTATGGACATGTCGACTATTCTTTGGCATGCTCTAACCTAACGAACGACACCAATCATGTAGTGATGACAAATTTCTGCCCTTTTTCCAATTGATGGATGTGCATAATCGATAGG
GGCTCACACGGTGGGGATGGCACGGTGCGAGAATTTCCGAGCGCGGATCTACGGGGACTTTGAAGCGACATCCGGGGCCAGTCCTGCCTCAAAGGTGTACCTCAGCCACTTGATGTCGGT
CTGCCCCCCGATAGGGGGAGGAAACAACAACGTCGCGCCTATGGATTCCGTGACTCCCAACCTGTTCGACAACTCCTTCTATCACCTGCTCCTACAGGGGGAGGGCCTGCTCAACTCGGA
CCAGGAAATGTACTCGAGCATCCTGGCGGTCCAGACGAAGGAAATCGTGAAGAAGTACGCAGCCGACCCAATCGCCTTCTTTCAGCAGTTCTCGGAGTCGATGGTGAGGATGGGGAACAT
CACGAACCCGGAAAGCTTTGTCAATGGGGAAGTGAGGAAGAACTGTAGGTTTATAAACACATGGGCTCCAGAGATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCATCGCCACGCTCGACGCCCCGATTTTCCAAATTCCTGGCTCTCTTTCTCTTGTTAGGCTTCGGCAAAACATATTGCGCCAGCGACCCTCCATTGACGTTGGATTACTAC
AAGTCGTCGTGTCCGTCAGTGCTCGAGATTGTCAGGAAGGAGATGGAATGCGCCGTGCTCTCTGACCCTCGCAATGCCGCATTGATCATTCGGTTGCATTTCCACGACTGCTTTGTTCAG
GGATGCGACGGGTCGGTTTTGCTAGATGACACTATCACGCTCCACGGAGAGAAGAAAGCTCCCCCCAGCATAAATTCTCTAGGAGGGTTCAGGATCGTCGACCGCATCAAGAACATGCTT
GAATCCGAGTGCCCCGGAGTTGTCTCTTGCGCCGACATACTCACGGTTGCCGCAAGAGACGCTACGCTTTTG
GTTGGTGGACCTTATTGGGACGTACCCTTGGGAAGGAAGGACTCGAGG
ACAGCGAGCTACGAGCTCACCTCCGCCATCCCGACAGCTGACGAGAGCCTTCCGTCCATCATCTCCAAGTTCCTCTTCCAAGGCCTCTCCGTCACTGACATGGTCGCTCTCGCCG
GGGCT
CACACGGTGGGGATGGCACGGTGCGAGAATTTCCGAGCGCGGATCTACGGGGACTTTGAAGCGACATCCGGGGCCAGTCCTGCCTCAAAGGTGTACCTCAGCCACTTGATGTCGGTCTGC
CCCCCGATAGGGGGAGGAAACAACAACGTCGCGCCTATGGATTCCGTGACTCCCAACCTGTTCGACAACTCCTTCTATCACCTGCTCCTACAGGGGGAGGGCCTGCTCAACTCGGACCAG
GAAATGTACTCGAGCATCCTGGCGGTCCAGACGAAGGAAATCGTGAAGAAGTACGCAGCCGACCCAATCGCCTTCTTTCAGCAGTTCTCGGAGTCGATGGTGAGGATGGGGAACATCACG
AACCCGGAAAGCTTTGTCAATGGGGAAGTGAGGAAGAACTGTAGGTTTATAAACACATGGGCTCCAGAGATCTAA

Retrieve as FASTA