Entry information : EcamPrx98 ( EcC005381.20)
Entry ID 10315
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-10-30 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EcamPrx98 ( EcC005381.20)
Name (synonym) EcamPrx98 ( EcC005381.20)
Class Class III peroxidase     [Orthogroup: Prx017]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx98
start..stop
S start..stop
EgrPrx98 650 0 1..341 1..349
EguPrx98 649 0 1..341 1..349
EglPrx98 643 0 1..341 1..349
GhPrx05 380 7e-133 40..341 17..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..273 273 N° 2 1097..1279 183 N° 3 1441..2007 567  
join(1..273,1097..1279,1441..2007)


exon

Literature and cross-references EcamPrx98 ( EcC005381.20)
Protein sequence: EcamPrx98 ( EcC005381.20)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340
PWM (Da):   %s   36749.94 Transmb domain:   %s   i13-35o
PI (pH):   %s   8.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLIMLRTKRRSSSSNVVATAIIAVLVPLVMHVMGLSESEGQEQQKLRVGFYSKSCPPAESVVHAVVKEAVLSVPRNAAVLLRIHFHDCFVEGCDGSILIDNGDISERHAGAHAGVGGFEIIEAAKARLESTCPGVVSCSDIVAMAARDAVLLSYGPFYEVQTGRRDGRVSNWTLAAEMPDVNDSIHMLKAKFRQKGLKDKDLVLLSGTLLFTNRQM*SNSTGGSDPAINPRFLPVLKSICPPGGDVNVRLALDAATEFVFDDLILHNIKNGFAVISSDARLYDSRHTRRIVDLYTQNGTSYKHEKPPSFKVDFAASMVKMGRIGVKTGSQGEIRRVCSSFN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Join with EcC005381.20( Incorrect prediction from kazusa (3' end is missing. eXTRA 5' end has been removed)) and (EcS730322.10, Partial sequence from genomic. Incorrect prediction from kazusa (5' end is missing due to short contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAATAATGCTGAGGACGAAGAGAAGGTCCAGCTCCAGCAATGTCGTCGCGACGGCCATTATCGCAGTTCTCGTCCCCCTCGTCATGCATGTTATGGGCTTGTCGGAATCGGAAGGA
CAAGAGCAGCAAAAGCTTCGAGTCGGGTTTTACTCCAAAAGCTGTCCACCGGCTGAGTCCGTCGTCCACGCCGTCGTCAAAGAGGCGGTCCTCTCGGTCCCTCGGAACGCCGCCGTCTTG
CTTCGGATTCATTTCCACGACTGTTTCGTTGAG
GTGAATGATTTTGCCTTTTCCGCTCCCCTGAATAAATGTTTGTCTACGTTTGCAATCAATGCGTCTTCATACACGACATTTTTNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGTCGAATTGTTGCTTTGGTAGACTAGTCTCACTAAAATGTCAAGATAACATCGTACAAATGACAAACCAGAGCA
AGGATACTTACACACAAAGGGTGTTATGGTTAGTCGTGTAATTGATGGTGTCACATCTTGTACAATAAAATGTCGTGGCAAATAGTACCAAATGATCTAGTAAATATTTTTTACAGTTCC
ATCACGCGTGATCTTTGGTAAATAACCACCGATAGAAACCCTTGAAGTTACCCACTTTAATGGCTTCGCTGCATGATTTTTGGGGATCGGGAATCGCTTTTGTGATGTGCAAGGAGACAA
CATCATGGTCTGCTGAATAATTAAAAGGGCGGCACTGGAATTTCGTGGGACGACCTTCATTATTTTGGCTTGAGAACAGCAAATGATTGGTCAAAAAAGGGACTAAATCGACCTTGAAAA
TCTTTTTTCCGTCAATGATTTTATCAGTGTTATCGCTCCTTCTCCACAGACACAATAGGCAGTAATTTGTGCTGTCGTGGTAATTAATTTACACTAATTGTTGAGCAGTTTCTGATGACA
TATACATGTTAAACAGGGATGCGACGGGTCGATCCTGATCGACAATGGGGATATCAGCGAGCGGCACGCGGGGGCGCATGCGGGTGTGGGAGGCTTTGAGATAATTGAAGCGGCCAAAGC
TCGCTTGGAAAGCACTTGTCCCGGGGTCGTCTCTTGCTCCGATATCGTGGCTATGGCTGCTAGAGATGCTGTTTTGTTG
GTAGTTACTTTCCCCATCTTATATTCTTGCTGGCACAGATT
TTGCTATCCAAATACCATTTGATAGCTCTTTCCTTTAGAAGGAAAGGAAAAAAGGGAGAGAGAGGTGTCAATTTTGATTGCTCTGGTGGATTGAAGTTGTGTTGGCTTCGTATGGTGCAG

AGCTATGGCCCGTTCTATGAGGTGCAGACGGGGAGAAGAGACGGCCGCGTCTCAAACTGGACGCTTGCTGCAGAAATGCCGGATGTGAATGACTCGATTCATATGCTCAAGGCCAAGTTT
AGACAGAAGGGGCTTAAAGATAAAGACCTCGTTCTTCTCTCCGGTACGCTGCTCTTTACTAATCGGCAGATGTGATCNAATTCCACAGGCGGGTCAGACCCTGCGATTAACCCTCGCTTT
CTTCCGGTTCTCAAGTCCATATGCCCCCCCGGTGGGGATGTCAACGTGAGATTGGCTCTGGATGCCGCCACTGAGTTCGTGTTCGATGATCTGATACTTCACAACATCAAGAACGGATTT
GCCGTGATATCTTCGGACGCGAGGCTCTATGACAGCAGACACACCAGGCGGATAGTTGATCTGTATACTCAGAATGGGACTTCTTATAAGCACGAAAAACCACCGTCCTTCAAGGTGGAT
TTTGCAGCTTCGATGGTGAAGATGGGTCGGATTGGCGTGAAGACGGGTTCGCAAGGAGAGATTAGGAGAGTTTGCAGCTCTTTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTAATAATGCTGAGGACGAAGAGAAGGTCCAGCTCCAGCAATGTCGTCGCGACGGCCATTATCGCAGTTCTCGTCCCCCTCGTCATGCATGTTATGGGCTTGTCGGAATCGGAAGGA
CAAGAGCAGCAAAAGCTTCGAGTCGGGTTTTACTCCAAAAGCTGTCCACCGGCTGAGTCCGTCGTCCACGCCGTCGTCAAAGAGGCGGTCCTCTCGGTCCCTCGGAACGCCGCCGTCTTG
CTTCGGATTCATTTCCACGACTGTTTCGTTGAG
GGATGCGACGGGTCGATCCTGATCGACAATGGGGATATCAGCGAGCGGCACGCGGGGGCGCATGCGGGTGTGGGAGGCTTTGAGATA
ATTGAAGCGGCCAAAGCTCGCTTGGAAAGCACTTGTCCCGGGGTCGTCTCTTGCTCCGATATCGTGGCTATGGCTGCTAGAGATGCTGTTTTGTTG
AGCTATGGCCCGTTCTATGAGGTG
CAGACGGGGAGAAGAGACGGCCGCGTCTCAAACTGGACGCTTGCTGCAGAAATGCCGGATGTGAATGACTCGATTCATATGCTCAAGGCCAAGTTTAGACAGAAGGGGCTTAAAGATAAA
GACCTCGTTCTTCTCTCCGGTACGCTGCTCTTTACTAATCGGCAGATGTGATCNAATTCCACAGGCGGGTCAGACCCTGCGATTAACCCTCGCTTTCTTCCGGTTCTCAAGTCCATATGC
CCCCCCGGTGGGGATGTCAACGTGAGATTGGCTCTGGATGCCGCCACTGAGTTCGTGTTCGATGATCTGATACTTCACAACATCAAGAACGGATTTGCCGTGATATCTTCGGACGCGAGG
CTCTATGACAGCAGACACACCAGGCGGATAGTTGATCTGTATACTCAGAATGGGACTTCTTATAAGCACGAAAAACCACCGTCCTTCAAGGTGGATTTTGCAGCTTCGATGGTGAAGATG
GGTCGGATTGGCGTGAAGACGGGTTCGCAAGGAGAGATTAGGAGAGTTTGCAGCTCTTTCAAC

Retrieve as FASTA