Entry information : EcamPrx[P]07
Entry ID 10316
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EcamPrx[P]07
Name EcamPrx[P]07
Class Class III peroxidase     [Orthogroup: Prx092]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]07
start..stop
S start..stop
EgrPrx[P]07 273 9e-95 14..148 140..274
EgrPrx12 244 3e-82 1..148 187..334
EglPrx12 244 3e-82 1..148 187..334
EguPrx12 244 4e-82 1..148 187..334
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..34 34 N° 2 312..724 413  
join(1..34,312..724)


exon

Literature and cross-references EcamPrx[P]07
Protein sequence: EcamPrx[P]07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   148
PWM (Da):   %s   16332.94  
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GLDVLDLTTLLGGHSMGKTNCSFIADRLYNFNKTGKPDPSMDSSFLALMREQCPPNSKNQVYLDPDSGSNYSFSKSFYSRVLNHRAVLSIDQQIAANNDSSQIAEEYNASFEDFWKMLALSMSQMGNIKVLTGKQGEIRKNCRVVNGK

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. No prediction from Kazusa. (Big 5' end is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTTGGATGTGCTGGACCTTACTACTCTACTCGGTACAATTGAACCTCATATGAAAAGGTATTTAACTTGTGACCTCGTTAAATTACATTAGATCTCAAGCAATCCTTTTCGATTTTAA
TTTTTCGAAATCTCCATCTAATTGTCAGGATACGTAGAATTTTATCAGATATAGGATAGTCGAGAATATAATCCGAACCGATCCTCCCAATGATTACCTCTAAGTGCACGAAACGACATG
TTTATGTACTATGTCAAATATCAAAATCAGAACCAATTCCTAACTTGCCAAAACAATGTAAATTTTGCCAGGAGGGCATTCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACCGGCT
GTACAATTTCAACAAAACTGGCAAGCCAGACCCAAGCATGGACTCATCCTTCTTGGCCCTGATGAGGGAGCAATGCCCACCGAACTCTAAGAACCAAGTGTACCTTGACCCTGATTCAGG
CTCCAACTACAGCTTCAGCAAGTCATTCTACTCCAGGGTCTTGAACCACCGTGCCGTCCTCAGCATCGACCAGCAGATCGCTGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAA
TGCCAGTTTTGAGGACTTCTGGAAGATGTTGGCCCTATCGATGAGCCAGATGGGGAACATCAAGGTCTTGACGGGGAAGCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAA
GTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGTTTGGATGTGCTGGACCTTACTACTCTACTCGGAGGGCATTCAATGGGCAAGACCAACTGCAGCTTCATCGCGGACCGGCTGTACAATTTCAACAAAACTGGCAAGCCAGACCCAAGC
ATGGACTCATCCTTCTTGGCCCTGATGAGGGAGCAATGCCCACCGAACTCTAAGAACCAAGTGTACCTTGACCCTGATTCAGGCTCCAACTACAGCTTCAGCAAGTCATTCTACTCCAGG
GTCTTGAACCACCGTGCCGTCCTCAGCATCGACCAGCAGATCGCTGCCAACAACGACAGCTCCCAGATCGCTGAGGAGTACAATGCCAGTTTTGAGGACTTCTGGAAGATGTTGGCCCTA
TCGATGAGCCAGATGGGGAACATCAAGGTCTTGACGGGGAAGCAGGGGGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAGTAA

Retrieve as FASTA