Entry information : EcamPrx[P]80 ( EcC054530.50)
Entry ID 10317
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EcamPrx[P]80 ( EcC054530.50)
Name (synonym) EcamPrx[P]80 ( EcC054530.50)
Class Class III peroxidase     [Orthogroup: Prx034]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]80
start..stop
S start..stop
EcamPrx78 293 3e-101 1..156 1..156
EgrPrx81 292 5e-101 1..156 1..156
EguPrx78 292 6e-101 1..156 1..156
EglPrx81 292 6e-101 1..156 1..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..273 273 N° 2 785..922 138 N° 3 1527..1583 57  
join(1..273,785..922,1527..1583)


exon

Literature and cross-references EcamPrx[P]80 ( EcC054530.50)
Protein sequence: EcamPrx[P]80 ( EcC054530.50)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   156 (125)
PWM (Da):   %s   16744.36 (13374.7)  
PI (pH):   %s   8.06 (7.85) Peptide Signal:   %s   cut: 32 range:32-156
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPHLTSHSSPLTCSSTLFIALILFCSQPNRSTTAAAANATGRHRQTSFNYYTKSCPQVEQLIGSVTSQQFKEAPVSGPATIRLFFHDCFVEGCDGSILISSKPGSKELAEKDAIDNKDLRAEGFKTIAKTKSFVENKCPGFVSCADILAIAARDFV

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from kazusa (3' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCATCTCACTTCTCATTCTTCCCCTCTAACTTGCTCATCGACCCTTTTCATCGCCCTCATCCTCTTCTGCAGCCAACCGAACCGATCCACCACAGCTGCTGCCGCCAATGCCACA
GGCCGCCACCGCCAGACGTCGTTCAACTACTACACCAAGTCGTGCCCCCAGGTCGAGCAACTCATTGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCTGGGCCGGCCACC
ATCCGGCTCTTCTTCCATGACTGCTTCGTTGAG
GTAAAATCTCTCTCTCTCTCTCTCTGCACTTACTTTCACGTGCATGCAATAGCAGCAGAGGAAGTCAATATTCAGGCAGATGCTACT
AGCAGTTGAGCAACTCCCCACATTTTGAGCGTCTTTTGTTATCTATGGTGACCGAATCCTTGCATATTCTTGTTTCTACACGAATGAGTCCGTATACAACATCACTAAAAGAAATTACAA
TTTTCATCGGCTAATCTTACCAAAAATTCAATTCAACCCTCCGGTGAGTGTTTCGTGTTTTGTTATTATTGCATTCCCCGAACCTGCCATAACTGTCAATCAAAGTCGGCCACGCATGGA
TCCCGAGTCGATAATTCTCTTCATTTTCTTAGCAAGCGAGAGAATCTACCATGAAAAACATGGAGAATCATCAACTAGCGAGATTACTATCGGTAAACGCCGTTCATTTGTTAATCAATC
GAGTAGGGCGATAATCCTAGCATAGAAACTACTGACTCTGCATGAGTTATGACCGATGTGGAAGGGATGTGACGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCTGA
GAAGGACGCGATTGACAACAAAGATTTGAGGGCGGAGGGATTCAAGACAATCGCGAAAACCAAGTCCTTCGTGGAGAATAAG
GTGCTGCATGAGAACATTTCTCATTCTCACAATTTTTG
TTCTTTAGTCCCCCGGAACAAAAAAAAAAAAAAAAAACAGAAACCCGTTTGGTAACGCCAAATTGTTTTTCTATTCCCCGGAATAGAAAGTTAGCCCGGGAATAGATTTAAAGCAGAAAT
GAGAAGCAAAAAAAAAAAAATTGCTTCTGTTCCCGGGAACAATTTCTAGAAATAAGCTACTTTTCTTTTTTATTTTTCTTTTATTCCTCTCTCTTGCCGCAGCCACCTCCGACCGCCCAG
AGCCACCGCCGACCGCCGCCGGTCACCGGCACCGCCGGTTGCCGTCGCCGTCATCAGCCGCCGTTGCTGGTCGCCGCCGCCGAGCGGCTCGGCAGCGGCAATCCGTGAGCAAGAATAAAA
AAACGAATAAATACAAAAAAGAAATTATTGCGTTACCAAACACATTTCTATTCTTTTTCTATTCCAATAGTAGAAATTTTGTGTAGTTACCAAACGGGTTATTTTACTTAGAAATTGTTC
CCCAAAATAGAAATAGAAAAGAATTATTTCTGAAAAAAAAAAAAAACTCTTCCCCAGCTAAAAAGTGTTACCATTCGCACCCTAAATGCCCCGGCTTCGTTTCTTGTGCTGACATTCTCG
CCATCGCTGCCAGAGACTTTGTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCCATCTCACTTCTCATTCTTCCCCTCTAACTTGCTCATCGACCCTTTTCATCGCCCTCATCCTCTTCTGCAGCCAACCGAACCGATCCACCACAGCTGCTGCCGCCAATGCCACA
GGCCGCCACCGCCAGACGTCGTTCAACTACTACACCAAGTCGTGCCCCCAGGTCGAGCAACTCATTGGGTCGGTCACGAGCCAGCAGTTCAAGGAAGCGCCGGTCTCTGGGCCGGCCACC
ATCCGGCTCTTCTTCCATGACTGCTTCGTTGAG
GGATGTGACGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTGGCTGAGAAGGACGCGATTGACAACAAAGATTTGAGG
GCGGAGGGATTCAAGACAATCGCGAAAACCAAGTCCTTCGTGGAGAATAAG
TGCCCCGGCTTCGTTTCTTGTGCTGACATTCTCGCCATCGCTGCCAGAGACTTTGTT

Retrieve as FASTA