Entry information : EcamPrx73 (EcC054690.120)
Entry ID 10319
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-10-30 (Qiang Li)
Peroxidase information: EcamPrx73 (EcC054690.120)
Name (synonym) EcamPrx73 (EcC054690.120)
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx73
start..stop
S start..stop
EgrPrx73 660 0 1..326 1..326
EglPrx73 656 0 1..326 1..326
EguPrx73 652 0 1..326 1..326
RcPrx44 506 0 5..326 7..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 854..1033 180 N° 3 1121..1286 166 N° 4 1719..2131 413
join(1..219,854..1033,1121..1286,1719..2131)


exon

Literature and cross-references EcamPrx73 (EcC054690.120)
Protein sequence: EcamPrx73 (EcC054690.120)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   34936.68 (32027.1) Transmb domain:   %s   i5-24o
PI (pH):   %s   6.5 (6.13) Peptide Signal:   %s   cut: 27 range:27-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METRVFTLNHLIFLVIFLAHVVASSAQLSFGFYAASCPAAESIVRNTVRSASSSDPTIPGKLLRLLFHDCFVEGCDASVLIRGNGTEQNDPANTSLGGFSVIDSAKRVLELFCPGTVSCADIIALAARDAVELTGGPAVQIPTGRKDGRVSAASNVRPNIVDTSFTINEMIKLFSSKGLSLADLVALSGAHTIGAAHCSAFSDRFQADSKGKFTLIDSSLDKNYAEELMRRCPAGASPSITVNNDPETSVSFDNQYYRNLLLHKGLFQSDSVLVKDNRTREKVENFANDQDSFFASWAQSFLKLSVVEVKTGNAGEVRKSCSLIN

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACCAGAGTTTTCACTTTGAATCATCTCATTTTTCTCGTCATCTTCCTAGCTCATGTGGTTGCCTCTTCCGCTCAGCTGTCTTTTGGCTTCTATGCTGCTTCATGTCCTGCTGCT
GAATCCATAGTCAGGAACACAGTGAGATCAGCTTCTTCCAGTGACCCCACAATCCCTGGGAAGCTCCTTCGATTACTCTTTCATGACTGCTTCGTGGAG
GTTAGTCTTCTTCTCTTCACT
GCTCACTTTAGAAAGAGACAGATTCTTGTAGTCTTGAAACTCGTGCAAAGAATGTACTTCATGCCTCCTAGTATCCAATGGACAGCTTCGCATAATGTTTCTCAGTAAAAGACTGAACCG
TGAACTTTATTGGGTTCCTACGGACGGAAATTTTAGCCAAGTTTGACTTATGTTTATTGAATCTGTATAATTCCATTTTAGCCAAAGGAAATTTAAAGCTCGAGACAGCGACTCAAATGT
TCCTTTGCTTCTAGTGTTTGGCCAAGGAAGAAGATCTCATGAACTTTATAGGAAGTCCTGAAGAAGTGAGAAATCTTTCTGAGGTCATAATGGATGAATTATCCATGGAAACTGAGAAGA
TAGCGACAGTCATTTCAAATACTACAGGCTTACTTTCTTCAAGCAATCTATGTTCCTAAATGCAAAGAGAAGTCTCTCCATTCATCATCGTGTATGAAATTATTCACTTGTAAATTTTTC
CTGTGTGCGGTCTTGCTGACACTTCATGCTTCTCCTGAGTCTGTCTCCTAACTTAAGCCAAGAAGTTAGGCCTGTTTCTGAAGTGACTATAATTTCAATATCAATTTGACTGATTACTAT
GATATGGTAGTAGGGTTGCGATGCATCCGTGCTTATACGAGGAAATGGAACAGAGCAAAATGATCCAGCTAATACATCACTTGGAGGATTTTCTGTCATAGACTCAGCTAAAAGGGTTTT
AGAATTATTCTGTCCAGGAACCGTTTCTTGTGCCGATATAATTGCATTAGCTGCCAGGGATGCTGTTGAACTG
GTAATGCAGATTCTCAATACTACCTTTTGCCTTTCCAAATTTTTTAG
TACAAGGTTTTTGCACTGAATTATGCATGCTTCAATGCAGACTGGAGGGCCTGCAGTTCAGATTCCAACAGGTAGGAAAGATGGGAGAGTTTCTGCAGCTTCAAATGTAAGACCCAACAT
CGTGGATACAAGTTTTACAATCAACGAGATGATTAAACTCTTCTCGTCTAAGGGGCTGTCCTTGGCTGATCTTGTCGCACTGTCAG
GTATAATTGGAATATATCAGCTCCTAAAAGCAAA
ACAAGGTCAAGAACAGTTAGTAGTGCGGGCACCATGTTCGGAAAATTTCCCTAAGAATAGTTGTTAACAAAAATATTGATTTTCGGGTCATTTCTTTTCTAATGAAATAATAACGACAAT
GCAAAGGACTTTTCTCCTTATAGCTGGAATCACATGAACAAAATATTCCCAGGTACTTGCATTCCCCTGACCATCAGAAAAGGAAACGGATTCGAGTCAATGGGAAATTTTGGGATTGAT
GGGTCAACGAAAATGTTAGAATTGTGGATAACAAATCACTTAGGCAAATCCTAGTTGCTAGTTCATGAAATGGAGGAAGTAAGGTTTAGTTTTAAAGACAAGATCATTGGAGCATCCATT
GCCTACAGTTGGTAATATTATGTGCTTTGAGGTGACAGGTGCACATACCATAGGAGCGGCTCACTGCAGTGCATTCAGCGACAGATTCCAAGCTGACTCCAAGGGGAAGTTCACCCTAAT
TGACTCATCCCTCGACAAGAATTATGCAGAGGAACTCATGAGACGGTGCCCTGCAGGTGCTAGTCCTTCCATTACAGTTAACAACGACCCTGAAACATCCGTGTCATTTGACAATCAGTA
CTACCGAAATCTCTTGTTGCACAAGGGGCTATTTCAGTCAGATTCTGTACTGGTAAAGGATAACAGAACAAGGGAGAAAGTAGAGAATTTCGCGAATGACCAGGACAGTTTCTTTGCAAG
CTGGGCTCAGTCATTCTTGAAGCTCAGTGTAGTTGAAGTAAAAACAGGCAATGCGGGGGAGGTGAGAAAATCTTGCTCACTTATTAACGGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACCAGAGTTTTCACTTTGAATCATCTCATTTTTCTCGTCATCTTCCTAGCTCATGTGGTTGCCTCTTCCGCTCAGCTGTCTTTTGGCTTCTATGCTGCTTCATGTCCTGCTGCT
GAATCCATAGTCAGGAACACAGTGAGATCAGCTTCTTCCAGTGACCCCACAATCCCTGGGAAGCTCCTTCGATTACTCTTTCATGACTGCTTCGTGGAG
GGTTGCGATGCATCCGTGCTT
ATACGAGGAAATGGAACAGAGCAAAATGATCCAGCTAATACATCACTTGGAGGATTTTCTGTCATAGACTCAGCTAAAAGGGTTTTAGAATTATTCTGTCCAGGAACCGTTTCTTGTGCC
GATATAATTGCATTAGCTGCCAGGGATGCTGTTGAACTG
ACTGGAGGGCCTGCAGTTCAGATTCCAACAGGTAGGAAAGATGGGAGAGTTTCTGCAGCTTCAAATGTAAGACCCAACATC
GTGGATACAAGTTTTACAATCAACGAGATGATTAAACTCTTCTCGTCTAAGGGGCTGTCCTTGGCTGATCTTGTCGCACTGTCAG
GTGCACATACCATAGGAGCGGCTCACTGCAGTGCA
TTCAGCGACAGATTCCAAGCTGACTCCAAGGGGAAGTTCACCCTAATTGACTCATCCCTCGACAAGAATTATGCAGAGGAACTCATGAGACGGTGCCCTGCAGGTGCTAGTCCTTCCATT
ACAGTTAACAACGACCCTGAAACATCCGTGTCATTTGACAATCAGTACTACCGAAATCTCTTGTTGCACAAGGGGCTATTTCAGTCAGATTCTGTACTGGTAAAGGATAACAGAACAAGG
GAGAAAGTAGAGAATTTCGCGAATGACCAGGACAGTTTCTTTGCAAGCTGGGCTCAGTCATTCTTGAAGCTCAGTGTAGTTGAAGTAAAAACAGGCAATGCGGGGGAGGTGAGAAAATCT
TGCTCACTTATTAACGGG

Retrieve as FASTA