Entry information : EcamPrx112 (EcC054713.120)
Entry ID 10320
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx112 (EcC054713.120)
Name (synonym) EcamPrx112 (EcC054713.120)
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx112
start..stop
S start..stop
EgrPrx112 635 0 1..319 1..319
EglPrx112 631 0 1..319 1..319
EguPrx112 629 0 1..319 1..319
EglPrx113 618 0 1..319 14..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..219 219 N° 2 343..534 192 N° 3 690..852 163 N° 4 1002..1384 383
join(1..219,343..534,690..852,1002..1384)


exon

Literature and cross-references EcamPrx112 (EcC054713.120)
Protein sequence: EcamPrx112 (EcC054713.120)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (294)
PWM (Da):   %s   34456.89 (31960.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.76 (9.88) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATHDIVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKKEIRTGASLLRLNFHDCFVNGCDASILLDDTPSFVGEKTAFPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRKDSITASWSLANTLPSPASNLSALITSFAAKGLSVKNMVALSGSHTIGLARCSSFRGRIYNDSNIDTSFAHKLQKTCPKIGNDSVLQRLDIQTPTFFDNLYYRNLLQKKGLLHSDQELFNGSSVDSLVKKYACDTEKFFRDFVRAMIKMSEIKPPKGSNGQIRKNCRKV

Retrieve as FASTA  
Remarks Coplete sequence from genomic. Incorrect prediction from kazusa (5' end is missing which has been completed manully).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACGATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTACCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAAAGAGATCCGGACAGGCGCGTCCTTGCTTCGGCTGAACTTCCATGACTGCTTTGTCAAT
GTGATTCGCGTCTTCTAGAGA
TTCCTTGCGAAACGATCCCACTTTGATTCATTAGCCTTCCAGAGTTTTCCTCTTCTTTTCCTTCCTCCTCAATATTGATGTGTGTATCTACGTATTGGTCAGGGGTGCGATGCGTCGATA
TTGTTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCATTTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGA
GTGGTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAAATAAAAGAAATGAGAATATGTCGACTCTAAT
TTAGTACATTTTTGCCTCGACGGTTATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCTCGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAG
GGAGAAAGGATTCCATTACAGCTAGCTGGAGCCTTGCTAACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGG
TGGCTCTTTCTG
GTAATCTCAACTCAATATTATCAACCTTGCACCGCGCATTACAACCAAGAATATTCAAAAGAAAAGAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAATGT
CGATGTACTTTATCAGCTGACAGTGGTTTTCAAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCAGTTCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTT
CGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCGCAATTTACTGCAGAAGAA
GGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACAGAAAAATTTTTCCGAGACTTTGTTAGGGCAATGATCAAAAT
GAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTACACACGATATCGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTACCAATCAACATGTCCGAAAGCA
TTGTCGATTGTTCGAGCTGGAGTAGCAAAAGCAATCAAGAAAGAGATCCGGACAGGCGCGTCCTTGCTTCGGCTGAACTTCCATGACTGCTTTGTCAAT
GGGTGCGATGCGTCGATATTG
TTGGATGACACGCCTAGCTTCGTGGGCGAGAAAACAGCATTTCCGAACAACAACTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTG
GTTTCCTGTGCAGATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTCCATTACAGCTAGCTGGAGCCTTGCT
AACACCCTACCTTCACCTGCTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTAAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGA
TGCAGTTCCTTCCGAGGACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGACATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATC
CAAACGCCGACCTTCTTTGACAACCTTTACTACCGCAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTAT
GCATGCGACACAGAAAAATTTTTCCGAGACTTTGTTAGGGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAAC

Retrieve as FASTA