Entry information : EcamPrx113 (EcC054713.90)
Entry ID 10323
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx113 (EcC054713.90)
Name (synonym) EcamPrx113 (EcC054713.90)
Class Class III peroxidase    [Orthogroup: Prx042]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx113
start..stop
S start..stop
EglPrx113 641 0 1..315 19..333
EguPrx113 639 0 1..315 1..315
EgrPrx113 639 0 1..315 1..315
EguPrx112 610 0 2..315 7..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..204 204 N° 2 328..519 192 N° 3 677..842 166 N° 4 992..1374 383
join(1..204,328..519,677..842,992..1374)


exon

Literature and cross-references EcamPrx113 (EcC054713.90)
Protein sequence: EcamPrx113 (EcC054713.90)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (295)
PWM (Da):   %s   33860.52 (31901.4)  
PI (pH):   %s   9.64 (9.64) Peptide Signal:   %s   cut: 21 range:21-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVGFSIVVVLLATSVITTAGCKLSPSHYQSTCPKALSIVRAGVAKAIKNETRTGASLLRLHFHDCFVNGCDASILLDDTPSFEGEKTAAPNNNSVRGFEVIDRIKASLEKECPGVVSCADIVALAARDSVVHLGGPSWTVSLGRKDSITASRSLANTSIPPPTSNLSALITSFAAQGLSVKNMVALSGSHTIGLARCTSFRARIYNDSNIDTSFAHKLQKICPKIGNDSVLQRLDIQTPTFFDNLYYHNLLQKKGLLHSDQELFNGSSVDSLVKKYACDTGKFFRDFAKAMIKMSEIKPPKGSNGQIRKNCRKV

Retrieve as FASTA  
Remarks Complete sequence from genomic. Incorrect prediction from kazusa (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGA
GCCGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACGGGCGCATCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GTGAGTCGCGTCTTCTAGAGATTCCTTGCGAAACGA
TCCCACTTTGATTCATTAGCCTTTCAGAGTTTTCCTCTTCTTTTCCTTTCTCTTCAATATTGATGTGTGTATCTACGTATTGGTCAGGGGTGCGATGCGTCGATATTGTTGGATGACACG
CCTAGCTTTGAGGGCGAGAAAACAGCAGCTCCGAACAACAATTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCA
GATATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
GCAAGTCCTCTTCATGACCTTAAAAAGTCTCGCAGATAAAAGAAATGAGAATATGTCGACTCTAATTTAGTACATTTTTGC
CTCGCCGGCTATAATCGGACAAATCTATTTTTTTCCTGATTTCTTCTATGTTTTCCCTTGTGTGACATGGTCCCAGTTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTC
CATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCTCCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTC
TG
GTAATTTCAACTCAATATTATCACCTTTCACCGCGCATTACAACCAAGAATATTCAAAAGAAAAAAAACCAGAATTCAGCACCTATCGTGATTCTGTTTTGGCAACGTCGATGTACTT
TATCAGCTGACAGCGGTTTTCAAATTGACAGGTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTCCGAGCACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAA
TTGCAGAAGATATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACCTTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTT
CACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACAGGAAAATTTTTCCGAGATTTTGCCAAAGCAATGATCAAAATGAGCGAAATT
AAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTCGGCTTTTCCATCGTCGTTGTCCTCCTTGCCACTTCGGTTATCACCACTGCCGGTTGTAAGCTCTCGCCCAGTCATTATCAATCAACATGTCCGAAAGCATTGTCGATTGTTCGA
GCCGGAGTAGCAAAAGCAATCAAGAATGAGACCCGGACGGGCGCATCCTTGCTTCGGCTGCACTTCCATGACTGCTTCGTCAAT
GGGTGCGATGCGTCGATATTGTTGGATGACACGCCT
AGCTTTGAGGGCGAGAAAACAGCAGCTCCGAACAACAATTCCGTGAGAGGGTTCGAAGTGATCGACCGCATCAAGGCTAGTCTGGAGAAGGAGTGCCCTGGAGTGGTTTCCTGTGCAGAT
ATCGTTGCCCTGGCTGCTCGCGACTCAGTCGTTCAT
TTGGGAGGTCCTTCATGGACCGTAAGCTTAGGGAGAAAGGATTCCATTACTGCTAGCAGGAGCCTTGCTAACACCTCCATACCT
CCACCTACTTCTAATCTCAGTGCTCTCATAACCAGCTTCGCTGCTCAGGGTCTTTCAGTCAAGAACATGGTGGCTCTTTCTG
GTTCACATACCATTGGCCTAGCGAGATGCACTTCCTTC
CGAGCACGGATCTACAACGACTCGAACATAGATACATCCTTCGCCCATAAATTGCAGAAGATATGTCCCAAGATTGGAAATGATAGTGTCCTTCAAAGGCTAGACATCCAAACGCCGACC
TTCTTTGACAACCTTTACTACCACAATTTACTGCAGAAGAAGGGCCTTCTTCACTCTGATCAAGAGCTCTTCAATGGCAGTTCTGTGGATTCACTGGTCAAGAAGTATGCATGCGACACA
GGAAAATTTTTCCGAGATTTTGCCAAAGCAATGATCAAAATGAGCGAAATTAAGCCCCCCAAAGGAAGCAATGGTCAAATAAGGAAAAATTGCAGGAAAGTGAAC

Retrieve as FASTA