Entry information : OsPrx23
Entry ID 1033
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2006-07-17 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx23
Name OsPrx23
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx23
start..stop
S start..stop
SiPrx07 548 0 33..358 34..356
SbPrx69 541 0 16..355 20..354
ZmPrx139 533 0 16..358 20..357
PviPrx03 521 0 30..349 26..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42438359..42438811 453 N° 2 42439194..42439817 624  
join(42438359..42438811,42439194..42439817)


exon

Literature and cross-references OsPrx23
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
DNA sequence http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=nucleotide&cmd=search&term=BN000552&doptcmdl=GenBank
Protein ref. UniProtKB:   Q94DM0
DNA ref. GenBank:   NC_008394.1 (42438359..42439814)
Protein sequence: OsPrx23
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (335)
PWM (Da):   %s   37709.15 (35579.1)  
PI (pH):   %s   7.62 (7.70) Peptide Signal:   %s   cut: 24 range:24-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATTLVMLVAAVACLCAPAAAGDGNADATRQPPVVSGLSFDFYRKSCPKAESVVRKFVRDAVRKDIGLAAGLLRLHFHDCFVQGCDASVLLDGSATGPGERQAPPNLTLRPSAFKAVNDIRDRLEKACGASVVSCSDILALAARDSVVASGGPEYKVPLGRRDSAEFASQQDVLSGLPPPTAAVPALLDALAKIKLDATDLVALSGGHTVGLAHCSSFEGRLFPRRDPAMNATFAGRLRRTCPAAGTDRRTPNDVRTPNVFDNMYYVNLVNREGLFTSDQDLFADAATKPIVEKFAADEKAFFDQFAVSMVKMGQISVLTGSQGQVRRNCSARNPGTVAAGDLPWSVLEVADSFVF*

Retrieve as FASTA  
Remarks chromosome 1. no ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGACGCTGGTAATGCTGGTAGCTGCCGTCGCTTGCCTGTGCGCTCCGGCGGCTGCCGGCGACGGCAACGCCGACGCGACGCGGCAGCCGCCGGTGGTGAGTGGCCTG
TCGTTCGACTTCTACAGGAAGAGCTGCCCCAAGGCGGAGTCCGTCGTGAGGAAGTTCGTCAGGGACGCCGTCCGCAAGGACATCGGCCTCGCCGCCGGCCTGCTCCGGCTCCACTTCCAC
GACTGCTTCGTGCAGGGCTGCGACGCCTCCGTGCTGCTCGACGGCTCCGCCACCGGCCCCGGCGAGCGGCAGGCGCCGCCCAACCTCACGCTGCGCCCGTCAGCGTTCAAGGCCGTCAAC
GACATCCGCGACCGCCTTGAGAAGGCGTGCGGCGCCTCCGTCGTCTCCTGCTCCGACATCCTCGCTCTCGCCGCCCGCGACTCTGTCGTCGCG
GTAAACGTATAAATTTAGAGTCTTACA
GTTTGCATGATCGTGAGGGCGTGTTGTGTATAATCGAAAATTATTTATACTTTTTAAGTAAATTTTATAGAACTATATATACTTGATCAAATTATTGTAAAAATACAGATTTAAGATAAT
GTATTAGAAATATATATTTAACAATAAATTTATCATAAAAACTATAGATTTAATAATTAATTAGCACAAAATTATAGCTTATAGGGTTTAAATTCTTAGCATTTATGTTATGCCTGAGTT
ATAAATATCCAAGTTTTTTACTAAATCAATATTTATGAAATTTCACAATTTATAGTTTTATGATAATTTAAAGTATCTGAAATTTACTTTTACTATTATTATTTTTGACGTGTAGTCAGG
AGGGCCGGAGTACAAGGTGCCACTGGGGCGGCGAGACAGCGCCGAGTTCGCGTCGCAGCAGGACGTGCTGAGCGGGCTGCCGCCGCCGACCGCCGCCGTGCCGGCGCTGCTGGACGCCCT
GGCCAAGATCAAGCTCGACGCCACCGACCTGGTGGCGCTCTCCGGCGGCCACACCGTGGGCCTCGCGCACTGCAGCTCCTTCGAGGGCCGCCTCTTCCCGCGCCGGGACCCGGCCATGAA
CGCCACCTTCGCCGGCCGGCTCCGGCGAACCTGCCCGGCGGCGGGCACCGACCGCCGGACGCCGAACGACGTCCGGACGCCCAACGTGTTCGACAACATGTACTACGTCAACCTTGTCAA
CCGGGAGGGGCTCTTCACCTCCGACCAGGACCTCTTCGCCGACGCCGCCACCAAGCCCATCGTCGAAAAGTTCGCCGCCGACGAGAAGGCATTCTTCGACCAGTTCGCCGTGTCCATGGT
GAAGATGGGGCAGATCAGCGTGCTCACCGGCTCGCAGGGCCAGGTTCGCCGGAACTGCTCAGCCAGAAACCCCGGCACCGTCGCCGCCGGCGACCTCCCGTGGTCCGTCCTCGAGGTTGC
AGACAGCTTCGTTTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTGCGACGACGCTGGTAATGCTGGTAGCTGCCGTCGCTTGCCTGTGCGCTCCGGCGGCTGCCGGCGACGGCAACGCCGACGCGACGCGGCAGCCGCCGGTGGTGAGTGGCCTG
TCGTTCGACTTCTACAGGAAGAGCTGCCCCAAGGCGGAGTCCGTCGTGAGGAAGTTCGTCAGGGACGCCGTCCGCAAGGACATCGGCCTCGCCGCCGGCCTGCTCCGGCTCCACTTCCAC
GACTGCTTCGTGCAGGGCTGCGACGCCTCCGTGCTGCTCGACGGCTCCGCCACCGGCCCCGGCGAGCGGCAGGCGCCGCCCAACCTCACGCTGCGCCCGTCAGCGTTCAAGGCCGTCAAC
GACATCCGCGACCGCCTTGAGAAGGCGTGCGGCGCCTCCGTCGTCTCCTGCTCCGACATCCTCGCTCTCGCCGCCCGCGACTCTGTCGTCGCG
TCAGGAGGGCCGGAGTACAAGGTGCCA
CTGGGGCGGCGAGACAGCGCCGAGTTCGCGTCGCAGCAGGACGTGCTGAGCGGGCTGCCGCCGCCGACCGCCGCCGTGCCGGCGCTGCTGGACGCCCTGGCCAAGATCAAGCTCGACGCC
ACCGACCTGGTGGCGCTCTCCGGCGGCCACACCGTGGGCCTCGCGCACTGCAGCTCCTTCGAGGGCCGCCTCTTCCCGCGCCGGGACCCGGCCATGAACGCCACCTTCGCCGGCCGGCTC
CGGCGAACCTGCCCGGCGGCGGGCACCGACCGCCGGACGCCGAACGACGTCCGGACGCCCAACGTGTTCGACAACATGTACTACGTCAACCTTGTCAACCGGGAGGGGCTCTTCACCTCC
GACCAGGACCTCTTCGCCGACGCCGCCACCAAGCCCATCGTCGAAAAGTTCGCCGCCGACGAGAAGGCATTCTTCGACCAGTTCGCCGTGTCCATGGTGAAGATGGGGCAGATCAGCGTG
CTCACCGGCTCGCAGGGCCAGGTTCGCCGGAACTGCTCAGCCAGAAACCCCGGCACCGTCGCCGCCGGCGACCTCCCGTGGTCCGTCCTCGAGGTTGCAGACAGCTTCGTTTTCTAG

Retrieve as FASTA