Entry information : EcamPrx01 (EcC005929.10)
Entry ID 10334
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-03 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: EcamPrx01 (EcC005929.10)
Name (synonym) EcamPrx01 (EcC005929.10)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx01
start..stop
S start..stop
EgrPrx16 696 0 1..337 1..337
EgrPrx01 694 0 1..337 1..337
EcamPrx16 694 0 1..337 1..337
EglPrx16 693 0 1..337 1..337
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..243 243 N° 2 424..609 186 N° 3 757..916 160 N° 4 1034..1455 422
join(1..243,424..609,757..916,1034..1455)


exon

Literature and cross-references EcamPrx01 (EcC005929.10)
Protein sequence: EcamPrx01 (EcC005929.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (311)
PWM (Da):   %s   37185.4 (34322.9)  
PI (pH):   %s   6.17 (6.25) Peptide Signal:   %s   cut: 27 range:27-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRWGLLLLLSELALVSLCTVQHVEAAEGLEPPLTLKWHYYRNSCRDAETYVRHQVEYYWKPDKSLTPKLLRLLYSDCFVTGCDASILLDGRNSEKTAPQNSGLEGYGTVVIDKIKQVLEQRCPGVVSCADILNLAARDAAHLAGAPSYPVLTGRRDGMSSSKASVDLPSPSISWEEALAYFESRNLDVLDLATLLGAHSMGKTHCSYITDRLYNYNSTGKPDPDMDPSYLAQMRKQCPPNSKSQGDPQVFLDPASGSSYTFSNSYYSRLLNHQATLGIDQQLARGDDTSQIAQEYDAGLEDFRKEFALSMARMGNIKVLTGNQGEIRKNCRAVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic. Correct prediction from kazusa. CONTAINING MOTIF YSDC
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCACGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACGCTGAAGTGGCACTAC
TACAGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTTCTCTACTCTGACTGCTTCGTC
ACG
GTACGTATCGTCCGTTGTCATCGCTTTCATACCGAGTTTCAGTAGGCTTTCTGAGCTCTCGAAATGGGCTTTCTAACGTATAATAATGGTGGAAACCGGGCATGTACGTGCAATAAC
TTGTTTTTTCTTTAATAAACAAAGCCTTGGATTGAGATACGTTTGGCTACCTGTGTAAAACAGGGCTGTGATGCGTCTATTCTGTTAGACGGGCGAAATTCAGAGAAAACAGCGCCACAA
AATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAACAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCC
GCTCACTTG
GTATGTGCCTGGTTTGCAGTTCTCTTCTTTGGCTTCAAAAGAGATTATTTTCACTGCCCTACCGATCATTGAAATGCTGCTAACTTGAACTTGTAGTATTAGATGTGAAAA
ACCAGAATCGCTGACACGATAATGTTTTTCTCACAGGCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCGTCATCCAAGGCGTCGGTGGACCTCCCGTCGCCA
TCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GTAAGATGGATCATTGTATAAAAAAAGTAAATAATTGATTTGGA
CCTCATCAAGTCATCGCTTTTTGAAACATTAAAATCAATTCCTAACTTTGCGCAAAAATATGAAATTGGACAGGGGCTCATTCAATGGGCAAGACTCACTGCAGCTACATCACAGACAGG
CTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCAAACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTT
GACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGACCAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATC
GCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTGACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGA
GCCGTGAACAGCAAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCGAGGTGGGGGTTACTGCTGTTGCTGTCGGAGCTTGCGTTGGTGAGCTTGTGCACGGTGCAGCACGTCGAGGCAGCAGAGGGGCTCGAGCCGCCGCTGACGCTGAAGTGGCACTAC
TACAGGAACTCGTGCCGCGATGCTGAGACGTATGTGAGGCACCAGGTCGAGTACTACTGGAAGCCGGACAAGAGCCTCACTCCCAAGCTCCTCCGACTTCTCTACTCTGACTGCTTCGTC
ACG
GGCTGTGATGCGTCTATTCTGTTAGACGGGCGAAATTCAGAGAAAACAGCGCCACAAAATTCAGGGCTTGAAGGGTATGGTACGGTGGTGATAGACAAGATCAAGCAAGTCCTGGAA
CAACGTTGTCCTGGAGTTGTGTCTTGTGCTGACATTCTCAACCTTGCTGCCAGAGATGCCGCTCACTTG
GCGGGAGCGCCATCTTACCCCGTCCTGACGGGGAGGAGAGACGGGATGTCG
TCATCCAAGGCGTCGGTGGACCTCCCGTCGCCATCCATCTCGTGGGAAGAGGCGCTCGCTTACTTCGAATCGAGGAACTTGGATGTGCTAGACCTTGCCACTCTACTTG
GGGCTCATTCA
ATGGGCAAGACTCACTGCAGCTACATCACAGACAGGCTGTACAATTACAACTCCACTGGCAAGCCAGACCCAGATATGGACCCATCCTACCTGGCCCAAATGAGGAAGCAATGCCCACCA
AACTCAAAGAGCCAAGGTGACCCTCAGGTGTTCCTTGACCCCGCCTCAGGCTCCAGCTACACATTCAGCAACTCCTACTACTCCAGGCTCCTGAACCACCAGGCCACCCTTGGCATCGAC
CAGCAGCTCGCCCGCGGTGACGACACTTCCCAGATCGCTCAGGAGTATGATGCTGGGCTGGAGGACTTCCGGAAGGAGTTCGCTCTGTCAATGGCCCGGATGGGGAACATCAAGGTCTTG
ACGGGGAATCAGGGGGAGATCCGCAAGAATTGCAGAGCCGTGAACAGCAAA

Retrieve as FASTA