Entry information : OsPrx26
Entry ID 1036
Creation 2006-07-17 (Filippo Passardi)
Last sequence changes 2010-08-04 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-05 (Qiang Li)
Peroxidase information: OsPrx26
Name OsPrx26
Class Class III peroxidase    [Orthogroup: Prx129]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx26
start..stop
S start..stop
SiPrx78 477 2e-171 30..326 24..320
BdiPrx97 472 2e-169 9..326 4..324
ZmPrx67 466 8e-167 31..326 25..320
ZmPrx36 463 7e-166 31..326 25..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7760171..7760401 231 N° 2 7760503..7760697 195 N° 3 7760790..7761344 555  
join(7760171..7760401,7760503..7760697,7760790..7761344)


exon

Literature and cross-references OsPrx26
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004).
Protein ref. UniProtKB:   Q5U1R7
DNA ref. GenBank:   NC_008395.1 (7760171..7761341)
Protein sequence: OsPrx26
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (301)
PWM (Da):   %s   33377.94 (30826.3) Transmb domain:   %s   i11-28o
PI (pH):   %s   7.34 (6.34) Peptide Signal:   %s   cut: 26 range:26-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAVGGRGRRPLLLLLLLLAVALALAARARAQLSPGFYSASCPTVHGVVRQVMSQAVMNDTRAGAAVLRLFYHDCFVGGCDASVLLDDTPAAPGEKGVGPNAVGSTTVFDLVDTIKAQVEAVCPATVSCADVLAIAARDSVNLLGGPSWAVPLGRRDALSPSRSAVSTDLPGPEADISALVSAFAAKGLSSRDLAALSGAHTVGRASCVNFRTRVYCDANVSPAFASHQRQSCPASGGDAALAPLDSLTPDAFDNGYYRNLVAGAGLLHSDQELFNNGPVDSVVQLYSSNAAAFSSDFAASMIRLGNIGPLTGSTGEVRLNCRKVNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2). 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCGGCGGGAGAGGGAGACGGCCGCTGCTCCTGCTCCTGCTCCTCCTCGCCGTGGCGCTGGCGCTGGCGGCGCGCGCGCGGGCGCAGCTGTCGCCGGGGTTCTACTCGGCGAGC
TGCCCCACCGTGCACGGCGTCGTGCGGCAGGTCATGTCGCAGGCCGTCATGAACGACACGCGCGCCGGCGCCGCCGTCCTCCGCCTCTTCTACCACGACTGCTTCGTCGGC
GTAAGGACC
GCGCCGCTCGCCGCCGTCCGGACGAACACATGCTGCCTCTTCTCCGCGCACTGCTAAGCTTTGATTTTGTGTTGTGGGGTTGGGGTTCACAGGGCTGCGACGCGTCGGTGCTCCTCGACG
ACACCCCCGCGGCGCCCGGCGAGAAGGGCGTCGGCCCCAACGCCGTCGGCTCGACGACCGTCTTCGACCTCGTCGACACCATCAAGGCCCAGGTCGAGGCCGTCTGCCCCGCCACCGTCT
CCTGCGCCGACGTCCTCGCCATCGCCGCGCGCGACAGCGTCAACCTG
GTCAGTCACACACACTCCACACACACACGCGCGCGCGCGCGCGCCATGTGTTCGACGCAATGACGCAAACCCT
GTTGTGCGCACGTGTGCAGCTCGGCGGGCCGAGCTGGGCGGTGCCGCTCGGCCGCCGCGACGCGCTGTCGCCGAGTCGGAGCGCGGTGTCGACCGACCTCCCGGGCCCCGAGGCCGACAT
CTCCGCGCTCGTCTCCGCCTTCGCCGCCAAGGGCCTGAGCTCGCGCGACCTCGCCGCGCTGTCCGGCGCGCACACCGTCGGCCGCGCCAGCTGCGTCAACTTCCGCACCCGCGTCTACTG
CGACGCCAACGTGAGCCCGGCGTTCGCGTCGCACCAGCGGCAGTCCTGCCCGGCGTCCGGCGGCGACGCCGCGCTGGCGCCGCTGGACTCCCTGACCCCCGACGCGTTCGACAACGGCTA
CTACCGCAACCTCGTCGCCGGCGCCGGGCTGCTGCACTCCGACCAGGAGCTGTTCAACAACGGGCCGGTGGACTCGGTGGTGCAGCTGTACAGCTCCAACGCCGCCGCCTTCTCGTCGGA
CTTCGCCGCGTCCATGATCAGGCTCGGGAACATCGGCCCGTTGACCGGGTCAACCGGCGAGGTCAGGCTCAACTGCAGGAAAGTGAATTCCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGTCGGCGGGAGAGGGAGACGGCCGCTGCTCCTGCTCCTGCTCCTCCTCGCCGTGGCGCTGGCGCTGGCGGCGCGCGCGCGGGCGCAGCTGTCGCCGGGGTTCTACTCGGCGAGC
TGCCCCACCGTGCACGGCGTCGTGCGGCAGGTCATGTCGCAGGCCGTCATGAACGACACGCGCGCCGGCGCCGCCGTCCTCCGCCTCTTCTACCACGACTGCTTCGTCGGC
GGCTGCGAC
GCGTCGGTGCTCCTCGACGACACCCCCGCGGCGCCCGGCGAGAAGGGCGTCGGCCCCAACGCCGTCGGCTCGACGACCGTCTTCGACCTCGTCGACACCATCAAGGCCCAGGTCGAGGCC
GTCTGCCCCGCCACCGTCTCCTGCGCCGACGTCCTCGCCATCGCCGCGCGCGACAGCGTCAACCTG
CTCGGCGGGCCGAGCTGGGCGGTGCCGCTCGGCCGCCGCGACGCGCTGTCGCCG
AGTCGGAGCGCGGTGTCGACCGACCTCCCGGGCCCCGAGGCCGACATCTCCGCGCTCGTCTCCGCCTTCGCCGCCAAGGGCCTGAGCTCGCGCGACCTCGCCGCGCTGTCCGGCGCGCAC
ACCGTCGGCCGCGCCAGCTGCGTCAACTTCCGCACCCGCGTCTACTGCGACGCCAACGTGAGCCCGGCGTTCGCGTCGCACCAGCGGCAGTCCTGCCCGGCGTCCGGCGGCGACGCCGCG
CTGGCGCCGCTGGACTCCCTGACCCCCGACGCGTTCGACAACGGCTACTACCGCAACCTCGTCGCCGGCGCCGGGCTGCTGCACTCCGACCAGGAGCTGTTCAACAACGGGCCGGTGGAC
TCGGTGGTGCAGCTGTACAGCTCCAACGCCGCCGCCTTCTCGTCGGACTTCGCCGCGTCCATGATCAGGCTCGGGAACATCGGCCCGTTGACCGGGTCAACCGGCGAGGTCAGGCTCAAC
TGCAGGAAAGTGAATTCCTGA

Retrieve as FASTA