Entry information : EcamPrx70 ( EcC007486.10)
Entry ID 10361
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2016-03-25 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-03-25 (Achraf Jemmat)
Peroxidase information: EcamPrx70 ( EcC007486.10)
Name (synonym) EcamPrx70 ( EcC007486.10)
Class Class III peroxidase     [Orthogroup: Prx011]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx70
start..stop
S start..stop
EguPrx70 376 3e-131 147..336 138..327
EguPrx70 113 4e-29 1..74 1..75
EgrPrx70 372 1e-129 147..336 138..327
EgrPrx70 111 1e-28 1..74 1..75
EguPrx69 359 3e-124 147..336 162..351
EguPrx69 116 5e-30 1..74 25..99
EglPrx69 357 6e-124 147..336 138..327
EglPrx69 117 7e-31 1..74 1..75
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..222 222 N° 2 611..827 217 N° 3 1027..1192 166 N° 4 1753..2159 407
join(1..222,611..827,1027..1192,1753..2159)


exon

Literature and cross-references EcamPrx70 ( EcC007486.10)
Protein sequence: EcamPrx70 ( EcC007486.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (310)
PWM (Da):   %s   28961.88 (26044.3) Transmb domain:   %s   i7-24o
PI (pH):   %s   8.48 (8.71) Peptide Signal:   %s   cut: 27 range:27-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLLMFLFLVHEVAQGQDLKVGFYRKACPNAEAIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxTGGLFYDVETGRRDGNVSSMKEAHDDLIPSKANITTLKIDFAKRGLSVKDLVVLSGGHTIGTSHCPSFSNRLYNFTGKGDTDPTLDSNYLARLKLSCKPDDQTTLVEMDPGSVRTFDIKYFNLIAKRRGLFTSDAALLDDSQTKAYLEFQIKTGGSTFFKDFGESMVKMGRIGVLTETAGEVRKVCSKVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. 5' is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCAAAGCTCTTCTTGTCTTGTTTGTTGCTTTTGATGTTCTTGTTTCTTGTCCATGAGGTTGCTCAAGGTCAGGATCTCAAAGTAGGGTTTTACCGGAAGGCATGCCCAAAC
GCAGAGGCCATTGTGAAGGAAGTTATCGGCCAAGTCATGTCCGTTGCTCCAAGTCTCTCTGGCCCTCTCTTGAGGCTGCATTTTCACGATTGTTTCGTTAGG
GTAAGTAAGAGAGCAAGC
TCCCATGCTCCTCTTCCTACTACGCGTTTGCAGTTTACCAGTTTCTTATGATTTGACTATTTGCATGTAACTAATGTTCGGAACCTAAGATAAGTAGTAACTGGCAAAAGAAGAGAGGGT
GAGAAGTTAGATCCTGGGCTTTTTATCTGAAGAGGTAATGCATGGTAGGGATGCATCGTTACGAACTGTTATCTTCATGAACTCACGGTTGAATATAATGCTTTATTCTGGGCTTTNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTAGCCACACTTATCTTAGAGGATAAGCACCGACAATTTTTATTA
ATGAGAAACACATTTTTATATAGAAATTGGGTTTTTTTTTTTTTTTTTTGGGTGTTGTTGCTTTAGACTGGAGGACTTTTCTATGATGTGGAAACTGGACGGAGAGATGGGAACGTTTCT
TCTATGAAGGAGGCGCATGATGATTTGATACCATCCAAAGCCAACATTACAACTCTGAAAATAGATTTTGCAAAGAGAGGCCTCAGTGTGAAGGATCTTGTCGTCCTATCAG
GTAACACC
TAATCTCTAATTATTGTTTCACATTGGTCCTATCAGGTAACACCTAATCTCTAATTATTGCTTCACATTCTTTGTCAAATATTTTGGGGAAATTTTTGAAAAGATGTGCCTATTTCCATA
CTTTGCTTAGGTCAAAGTAACTCTAATTTGTCGAGACAGACTCATGGCTTGCACAGCACAAGTCAAGCTTAGCTGCCTTCCCTTTCATTTTTCGGATGGTCAGTAATTTTCCATGCACTC
AGACTGAACGAAACAAAGTGACTTAGACAATTTTTTTTATTTTTTTTCGATAACCTCTGACCAATCTGAGCCGGGCCTTTGCGATCTCTAAACCCACGGATGAAAGCTCAAGTGCTGGAA
GGTATTCCTTCGATCGTGGTACGATCTCTAATGGGGAAAGCTCCCTCACCATATATAAAAATAGATAAGACATAAATTAATAGGGGAAATAACTGTTATTTGAGCGAGGGATACATAAAC
ACATCACCTGTACAGGGAGAAAACGTAATTTGTAACTGTAGATCATGCTAATTTTGATCTGCTATTAACCAGGTGGGCACACAATTGGAACATCACACTGCCCTTCCTTCTCCAACCGCC
TCTACAACTTCACCGGAAAGGGCGACACCGACCCCACGCTCGACTCCAACTACTTAGCCAGACTGAAGCTCAGTTGCAAGCCGGATGACCAAACCACTCTCGTCGAGATGGACCCGGGAA
GCGTGAGGACGTTCGACATCAAGTACTTCAATCTCATTGCGAAGAGAAGGGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACGAAGGCGTACCTTGAGTTCCAGATCA
AGACCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCGATGGTGAAAATGGGTCGGATTGGCGTGCTGACCGAAACGGCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCAAAGCTCTTCTTGTCTTGTTTGTTGCTTTTGATGTTCTTGTTTCTTGTCCATGAGGTTGCTCAAGGTCAGGATCTCAAAGTAGGGTTTTACCGGAAGGCATGCCCAAAC
GCAGAGGCCATTGTGAAGGAAGTTATCGGCCAAGTCATGTCCGTTGCTCCAAGTCTCTCTGGCCCTCTCTTGAGGCTGCATTTTCACGATTGTTTCGTTAGG
NNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
ACTGGAGGACTTTTCTATGATGTGGAAACTGGACGGAGAGA
TGGGAACGTTTCTTCTATGAAGGAGGCGCATGATGATTTGATACCATCCAAAGCCAACATTACAACTCTGAAAATAGATTTTGCAAAGAGAGGCCTCAGTGTGAAGGATCTTGTCGTCCT
ATCAG
GTGGGCACACAATTGGAACATCACACTGCCCTTCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCACGCTCGACTCCAACTACTTAGCCAGACTGAA
GCTCAGTTGCAAGCCGGATGACCAAACCACTCTCGTCGAGATGGACCCGGGAAGCGTGAGGACGTTCGACATCAAGTACTTCAATCTCATTGCGAAGAGAAGGGGCCTCTTTACTTCGGA
CGCCGCACTTCTTGACGACAGCCAAACGAAGGCGTACCTTGAGTTCCAGATCAAGACCGGTGGATCCACTTTCTTCAAGGACTTTGGAGAGTCGATGGTGAAAATGGGTCGGATTGGCGT
GCTGACCGAAACGGCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAATTAA

Retrieve as FASTA