Entry information : EcamPrx38 ( EcS621318.10)
Entry ID 10363
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EcamPrx38 ( EcS621318.10)
Name (synonym) EcamPrx38 ( EcS621318.10)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx38
start..stop
S start..stop
EguPrx[P]40 181 7e-61 2..103 30..131
EgrPrx[P]40 179 2e-60 1..103 29..131
EglPrx32 169 8e-54 1..105 29..134
EgrPrx32 169 9e-54 1..105 29..134
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..141 141 N° 2 260..433 174  
join(1..141,260..433)


exon

Literature and cross-references EcamPrx38 ( EcS621318.10)
Protein sequence: EcamPrx38 ( EcS621318.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   105
PWM (Da):   %s   11540.8  
PI (pH):   %s   6.33
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
DGLSPHYDYICPQALATIKHVIEAMVQQERRMGASLLRLHFHYCFVNGCDALMLLDPTPTINNEKLALHNNNSARGFKVIGQIKEEVDGVWGCPVVSCVDILAIT

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (Two ends are missing due to short contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACGGCCTCTCGCCACACTATGACTATATATGCCCTCAAGCCTTAGCCACCATCAAGCACGTCATTGAGGCGATGGTGCAGCAAGAGCGACGAATGGGTGCGTCCTTGCTGCGTTTGCAC
TTCCACTACTGTTTCGTCAAT
CTAAGACATAAACAGCTAAGTTTCACATTAATTTGTTGTTCTAAAAAATAGTGATTACTATTTAGCATTGCACAATACTTGCTAACATTGATGTTTGTT
TGGGAGTTCAATAATGCAGGGTTGTGATGCATTGATGCTCTTGGATCCGACCCCGACCATCAACAATGAAAAGCTTGCTCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATCGG
CCAAATTAAGGAGGAGGTCGATGGAGTATGGGGATGTCCGGTGGTATCTTGTGTGGACATCTTGGCAATCACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GACGGCCTCTCGCCACACTATGACTATATATGCCCTCAAGCCTTAGCCACCATCAAGCACGTCATTGAGGCGATGGTGCAGCAAGAGCGACGAATGGGTGCGTCCTTGCTGCGTTTGCAC
TTCCACTACTGTTTCGTCAAT
GGTTGTGATGCATTGATGCTCTTGGATCCGACCCCGACCATCAACAATGAAAAGCTTGCTCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATC
GGCCAAATTAAGGAGGAGGTCGATGGAGTATGGGGATGTCCGGTGGTATCTTGTGTGGACATCTTGGCAATCACT

Retrieve as FASTA