Entry information : EcamPrx126 ( EcC008302.10)
Entry ID 10369
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-02-15 (Christophe Dunand)
Peroxidase information: EcamPrx126 ( EcC008302.10)
Name (synonym) EcamPrx126 ( EcC008302.10)
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx126
start..stop
S start..stop
EgrPrx126 580 0 1..282 47..328
EguPrx126 578 0 1..282 47..328
EglPrx126 577 0 1..282 47..328
EgrPrx125 520 0 1..282 45..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..81 81 N° 2 477..668 192 N° 3 772..937 166 N° 4 1112..1521 410
join(1..81,477..668,772..937,1112..1521)


exon

Literature and cross-references EcamPrx126 ( EcC008302.10)
Protein sequence: EcamPrx126 ( EcC008302.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   30204.2  
PI (pH):   %s   7.07
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ITWSKAQADPTLGAKLLRVHYHDCFVRGCDGSVLLDPVGTNQSEKNAVPNLTLAGFDVIDDIKKQVEQACPNTVSCADVLSLAARDAVSFPFKKPMWDVLMGRRDGNISLASNIPGNLPSPFADFSTLAQIFSKKGLNVNDLVVLSGAHTIGVAHCGTFSRRLYNFTGKGDADPSLNATYAASLRTQCPNPANPATTVEMDPQSSLSFDSHYFDILIENEGLFQSDAALLTNQGAAKVVQHLRSPAAFFSEFGKSMKKMGAIEVLTGTAGEIRKQCRVVNQS

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa. 5' end is missing due to bac end.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGGGTAACAAATTCCTATATATCCCCAAAGTAGATTCCCTGA
TCGAAACATGTGAAGAGTAACTTCTATCTGCAATAAAAGTTGCCGACCTTTCTTCTCTATAGTGTGTGACTTGAGATTCCTGTCAACCTATCTAAAAGTTTAAGTCATTGTTATGCCAAT
AATCATCGTTGCTTGTTGAGACAGTAGGCAGGGAATATAGGGAACATATCTCAACCGTTCTGCATGGTTCATGCTTCACATCATATACGTTTGAACTTAGCGAGCTCAACTCTCCATGTG
ATGAGTTAGGGCTTAAGACGTATGACTTTGCATTTGACATTATTAGAGAAATAGTTGCATCTAATGTCTCTCAATCACACCAAGGTTGACGAAATTCTGGAATAATTCATTTTTAGGGAT
GTGATGGATCCGTACTGCTGGATCCTGTGGGAACAAACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCAAGAAACAAGTTGAGCAAG
CTTGCCCCAACACTGTCTCTTGTGCCGACGTTCTTTCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
GTAAGAAAACCTGCCTAATTGATTGTCTAAAATCATTAATTTCTTCGCTGAA
AATGGTCAAAGTATAAGGTTTGTCATTTGAATATGATGGCGTAAATTGCAGTTTAAGAAGCCGATGTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATTTCGTTAGCATCCAACATC
CCTGGGAACCTTCCATCTCCTTTCGCGGACTTTAGTACTCTTGCGCAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTAAGCCGACGTGATCATGTCCT
TTTTCGGATGGTTGAATTAAGATTTCCACACTTACATTTGGATCTTCAAATTAACATCGAAGCTAATTAAAGTACAAAACTGACATACTGCATTGAGTTAGACATTTCACAATGTACAAT
GAAATCATCTATATCTTTGCTCCTTCACCAGGTGCACATACCATTGGAGTTGCTCATTGCGGCACATTTTCCAGGAGGCTCTACAACTTCACGGGGAAAGGAGACGCTGACCCTTCTCTG
AACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACCCGGCCAACCCGGCTACAACGGTGGAAATGGATCCGCAAAGCTCACTTTCCTTCGATAGCCATTACTTCGATATTCTC
ATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCGCTCTTGACAAACCAAGGTGCAGCCAAGGTGGTGCAGCACCTCCGGTCGCCAGCCGCGTTCTTCTCCGAGTTTGGCAAGTCAATG
AAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCCGGTGAGATTAGAAAACAATGTCGTGTGGTGAATCAATCGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATCACTTGGAGCAAGGCCCAAGCTGACCCTACTCTGGGTGCTAAGCTTCTCAGAGTGCACTATCACGACTGCTTTGTCCGGGGATGTGATGGATCCGTACTGCTGGATCCTGTGGGAACA
AACCAGTCTGAGAAGAACGCAGTACCAAATCTCACTTTGGCTGGTTTTGATGTTATCGATGACATCAAGAAACAAGTTGAGCAAGCTTGCCCCAACACTGTCTCTTGTGCCGACGTTCTT
TCGCTTGCCGCTCGTGATGCGGTCTCTTTCCCT
TTTAAGAAGCCGATGTGGGATGTGTTGATGGGAAGAAGAGACGGCAACATTTCGTTAGCATCCAACATCCCTGGGAACCTTCCATCT
CCTTTCGCGGACTTTAGTACTCTTGCGCAAATTTTCTCCAAGAAAGGCCTCAATGTGAACGATCTCGTTGTTCTCTCTG
GTGCACATACCATTGGAGTTGCTCATTGCGGCACATTTTCC
AGGAGGCTCTACAACTTCACGGGGAAAGGAGACGCTGACCCTTCTCTGAACGCCACCTACGCTGCATCCCTCCGGACACAGTGCCCTAACCCGGCCAACCCGGCTACAACGGTGGAAATG
GATCCGCAAAGCTCACTTTCCTTCGATAGCCATTACTTCGATATTCTCATAGAAAACGAGGGATTGTTCCAATCCGATGCCGCGCTCTTGACAAACCAAGGTGCAGCCAAGGTGGTGCAG
CACCTCCGGTCGCCAGCCGCGTTCTTCTCCGAGTTTGGCAAGTCAATGAAGAAAATGGGGGCCATCGAGGTGCTCACGGGAACTGCCGGTGAGATTAGAAAACAATGTCGTGTGGTGAAT
CAATCGTAA

Retrieve as FASTA