Entry information : OsPrx27
Entry ID 1037
Creation 2006-06-23 (Filippo Passardi)
Last sequence changes 2006-06-23 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx27
Name OsPrx27
Class Class III peroxidase    [Orthogroup: Prx115]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Roots
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx27
start..stop
S start..stop
BdiPrx96 505 0 27..321 26..322
SofPrx08 503 0 27..321 28..324
SiPrx76 495 2e-178 30..321 31..325
ZmPrx37 490 9e-177 1..321 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7750479..7750700 222 N° 2 7750828..7751019 192 N° 3 7751748..7752299 552  
join(7750479..7750700,7750828..7751019,7751748..7752299)


exon

Literature and cross-references OsPrx27
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. GenPept:   BAD27598 UniProtKB:   Q6EUS1
DNA ref. GenBank:   NC_008395.1 (7750479..7752296)
Cluster/Prediction ref. UniGene:   Os.68693
Protein sequence: OsPrx27
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (294)
PWM (Da):   %s   33186.63 (30572.1)  
PI (pH):   %s   8.21 (7.98) Peptide Signal:   %s   cut: 28 range:28-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAGAVLVRRMVVVVAIAALVAPGEVAAQLTPTYYDGSCPSLQSIVRSAMAAAVQQEPRMGASILRLFFHDCFVNGCDASVLLDDSSTITGEKNAGPNANSLRGFEVIDSIKSQVEAACPGTVSCADILAVAARDGVNLLGGPTWAVQLGRRDTRTASQSAANSNLPSPSSSAAALVSAFASKGLDSRDMVALSGAHTIGAARCATFRARVYNDTNISPGFAVRRRQVCPASGGDGNLAPLDALSSVRFDNGYFRNLMGRFGLLHSDQELFNGGPVDSIAQQYAANGAAFSRDFVTAVVKMGNISPLTGSSGEVRSNCRKPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, 2 introns) and 3 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGAGCCGTGCTGGTGAGGAGAATGGTGGTGGTGGTTGCCATTGCCGCCTTGGTGGCGCCCGGCGAGGTGGCGGCGCAGCTGACGCCGACGTACTACGACGGCAGCTGCCCGAGC
CTGCAGTCCATCGTGAGGTCGGCCATGGCGGCCGCCGTGCAGCAAGAGCCCCGCATGGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAT
GTAAGTACACCATAGCTA
GCTAGCTAGCTTGAGAGTGGCCAGCCATGGCGGCTCTGAGAATGACGGCGGATGGGGATCGAGCTGATGGTCGCTCGCCGGCGTTCATGGCGATTATATATGATTGCAGGGGTGCGACGC
GTCGGTGCTGCTGGACGACTCGTCGACGATCACCGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGCTGCGCGGATTCGAGGTCATCGACTCCATCAAGTCGCAGGTCGAGGCCGCCTG
CCCCGGCACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGGCGTCAACCTG
GTAATTAATCAATTTACCAACCAATTTAATTAATAATTACTTTTACACTTGCATGCATG
TCAATTTTTTTTTTTACCGTGCGGCCGCTCGCCGACAGGCCGTACAGCCAACTCAAGCTGCAAATGCAACGCACTGCATCATGCCCGTGTCAAAAAGCCACCTACATTTTTAATGACGCA
CGCATGCTCGCGCCGCGCGACAAATTACAATCTAGAGCCATCCGCACATGCCGTACCCCCTCAGTCTCAAAATATTGTTTACATGTAATTCAAATAAAAAAATTTAACTCTAAATATTTT
CGTTACGAAATGCAAAAGTTAAATTTGGATTTACATATTTGTGGGAATGATATATCATATATTAATACATCTGCTTAATTTTTTTTAATTTTTTTAGAATTATTTGGGTGACGTGCAAAT
AAGGAAGGACATACCCTCAAGAGTTTAGAATAATTTCCTGTCCAATATCTCACTGCCATGTGGGCCATCCCCTCCCACGTCCATGTACAGTTGATTTGCGTTGATTTTACTTGCGGCTGC
ATGCATGACGAAAAATGATTGACGCTGATGGATGGATCGACCGATCGCCTTAGCCTGTCAATCTTGTCGTGCATGGGGTGTCAAGACCTGCCTAATCACCACACCAAATTGTAACTAAAC
TAATTTTACAGCGGTAATCAACTCGAGAGAAGTAAAACTAATTTGGTGCGTAAATTTGATTTGCTGCAGTTGGGTGGGCCGACGTGGGCGGTGCAGCTGGGGCGGCGCGACACGCGGACG
GCGAGCCAGTCGGCGGCGAACAGCAACCTGCCGTCGCCGTCGTCGAGCGCGGCGGCGCTGGTGTCGGCGTTCGCGTCCAAGGGGCTCGACTCCCGCGACATGGTGGCGCTGTCGGGCGCC
CACACCATCGGCGCCGCCCGGTGCGCCACCTTCCGCGCCCGCGTCTACAACGACACCAACATCAGCCCCGGGTTCGCCGTCCGCCGGCGGCAGGTGTGCCCGGCGAGCGGCGGCGACGGC
AACCTGGCGCCGCTCGACGCGCTCAGCTCCGTCCGCTTCGACAACGGCTACTTCCGCAACCTCATGGGCCGCTTCGGCCTCCTCCACTCTGACCAGGAGCTCTTCAATGGCGGGCCCGTC
GACTCCATCGCGCAGCAGTACGCCGCCAATGGCGCCGCCTTCTCCCGCGACTTCGTCACCGCCGTCGTCAAGATGGGCAACATCAGCCCGCTCACCGGCTCCAGCGGCGAGGTCCGCTCC
AACTGCCGGAAGCCCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGGAGCCGTGCTGGTGAGGAGAATGGTGGTGGTGGTTGCCATTGCCGCCTTGGTGGCGCCCGGCGAGGTGGCGGCGCAGCTGACGCCGACGTACTACGACGGCAGCTGCCCGAGC
CTGCAGTCCATCGTGAGGTCGGCCATGGCGGCCGCCGTGCAGCAAGAGCCCCGCATGGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTCAAT
GGGTGCGACGCGTCGGTG
CTGCTGGACGACTCGTCGACGATCACCGGCGAGAAGAACGCCGGGCCGAACGCCAACTCGCTGCGCGGATTCGAGGTCATCGACTCCATCAAGTCGCAGGTCGAGGCCGCCTGCCCCGGC
ACCGTCTCCTGCGCCGACATCCTCGCCGTCGCCGCCCGCGACGGCGTCAACCTG
TTGGGTGGGCCGACGTGGGCGGTGCAGCTGGGGCGGCGCGACACGCGGACGGCGAGCCAGTCGGCG
GCGAACAGCAACCTGCCGTCGCCGTCGTCGAGCGCGGCGGCGCTGGTGTCGGCGTTCGCGTCCAAGGGGCTCGACTCCCGCGACATGGTGGCGCTGTCGGGCGCCCACACCATCGGCGCC
GCCCGGTGCGCCACCTTCCGCGCCCGCGTCTACAACGACACCAACATCAGCCCCGGGTTCGCCGTCCGCCGGCGGCAGGTGTGCCCGGCGAGCGGCGGCGACGGCAACCTGGCGCCGCTC
GACGCGCTCAGCTCCGTCCGCTTCGACAACGGCTACTTCCGCAACCTCATGGGCCGCTTCGGCCTCCTCCACTCTGACCAGGAGCTCTTCAATGGCGGGCCCGTCGACTCCATCGCGCAG
CAGTACGCCGCCAATGGCGCCGCCTTCTCCCGCGACTTCGTCACCGCCGTCGTCAAGATGGGCAACATCAGCCCGCTCACCGGCTCCAGCGGCGAGGTCCGCTCCAACTGCCGGAAGCCC
AACTAA

Retrieve as FASTA