Entry information : EcamPrx94 ( EcS739179.10)
Entry ID 10370
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EcamPrx94 ( EcS739179.10)
Name (synonym) EcamPrx94 ( EcS739179.10)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx94
start..stop
S start..stop
EgrPrx94 662 0 1..330 1..326
EglPrx94 660 0 1..330 1..326
EguPrx94 649 0 1..330 1..326
GmPrx64 456 9e-163 33..330 48..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..234 234 N° 2 779..1133 355 N° 3 1392..1795 404  
join(1..234,779..1133,1392..1795)


exon

Literature and cross-references EcamPrx94 ( EcS739179.10)
Protein sequence: EcamPrx94 ( EcS739179.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (307)
PWM (Da):   %s   36258.4 (33832.0)  
PI (pH):   %s   8.68 (8.36) Peptide Signal:   %s   cut: 24 range:24-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAFVSSALFLVALHLISATVRAGGLPVEAYGLSFQYYQESCPNFEAIVNRKVKEWILKDYTLAPALMRLHFHDCVVRGCDASILLNHPGSERSAAESKTLRGFEVINDIKAALEKSCPKMASCADILTSAARDATVLAGGPFWMVPYGRKDGRVSVAKEASKVPVGHENGHENVTSLLQLFQSEGLNVLDLVVLSGAHTIGRSTCGSIQSRLYNYKSTGKPDPTLNREYGNYLKRKCRWASEYVYLDGRTPKTFDNMYYKNLQKKMGLLSTDQYLNSDSRTGPLVSALATQPELFNYQFGVSMAKLGNVQVLTGDEGEVRTNCNAVNRY

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3). Incorrect prediction from kazusa (5' is from EcS739179.10 and 3' end is from EcS528907.10). 3' end is Close to EcC074437.10 (Removed). Close to EcS545302.10 (Very short contig, removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGTCGTCGGCGCTGTTTCTCGTCGCCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGCGGGCTGCCTGTCGAAGCGTACGGGCTCTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAACAGGAAAGTGAAAGAATGGATTCTGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GTACGT
AGTTTGTCCGACCGCTTTTTCTTCTTTTCTTTCTTTTTTAAATGAAAAAGGGCTAAAGCAAAATAAAAATAAAAATTAGCTTCGTAAATATACTATTTCTATTTTATCACCTGATAATAA
TAATAAAAAATTAGTATTCCAGCACTTGTCAATTCCAAAGTTAGCAATCTAGTCAGCAGAGCAATTTCCTTCTCCAAAATTATGTTGGTCAGCATCAACCAAATTATTTTCGTAAGTTTT
GCAAAAATCGCACTTATTAATAAAGTCGTCGCTAAGAAAAGCAAACAAAAATTTATTATCTAGTAGTGTCCACATATAAAAATGACATACATAAGGCAATTTCAAAATCATAATGAGAAG
TCTTTATAGTTAATGAATCAATACACTAACATTAATTAACTTATTGCATTATAATTTATATCTCACTCTCGATTGAGTTTTCTATAGACCAAATCGAAAAATTTCGACATCCAAGTAAAT
CAAAATGCGAATTTTTGCCAGCTTAATTTGACTCGAGTTTCTTGATTTGATTGTGTAGGGATGCGACGCGTCGATACTATTGAACCACCCAGGGAGCGAGAGGAGCGCCGCGGAGAGCAA
GACTCTCAGGGGGTTTGAGGTGATCAACGACATAAAGGCGGCGCTTGAGAAGAGCTGCCCGAAGATGGCATCGTGCGCTGACATCCTGACCTCAGCCGCGAGGGATGCCACCGTGTTGGC
CGGCGGGCCTTTCTGGATGGTCCCGTACGGGCGCAAGGACGGGAGGGTCTCCGTCGCCAAGGAGGCCAGCAAGGTGCCGGTTGGTCACGAGAACGGTCACGAGAACGTCACGTCTCTCCT
CCAGCTTTTCCAATCCGAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GTGAACTTTTTCTCATTTCTTTTCACAAATCAACGAAAAAATAAATAATAAAAAAATTAAAGTCTAA
AACACTATATAGCAATTTTTATTTATATAGCAATTTTAGTCTATAGGGTGCTTTTTGAATGGATGTGAGGATTAGTTTATGAAATTTTTATGGTCAACTTTGATTAAAAAAAATCACCAT
GTATTCTCAAATATAATTGAAATGTACATTTTTAATTTTATTCCTTTTCCTTCTTCTTGATCCGGGTGCAGGCGCGCACACGATAGGGCGAAGCACCTGCGGGTCCATCCAATCGCGGCT
CTACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTACGTGTACCTCGACGGGAGGACGCCGAA
AACCTTCGACAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCCCTCGTGTCGGCGCTCGCCACCCAGCC
CGAGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGCAACGCCGTCAACCGCTACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGTCGTCGGCGCTGTTTCTCGTCGCCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGCGGGCTGCCTGTCGAAGCGTACGGGCTCTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAACAGGAAAGTGAAAGAATGGATTCTGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GGATGC
GACGCGTCGATACTATTGAACCACCCAGGGAGCGAGAGGAGCGCCGCGGAGAGCAAGACTCTCAGGGGGTTTGAGGTGATCAACGACATAAAGGCGGCGCTTGAGAAGAGCTGCCCGAAG
ATGGCATCGTGCGCTGACATCCTGACCTCAGCCGCGAGGGATGCCACCGTGTTGGCCGGCGGGCCTTTCTGGATGGTCCCGTACGGGCGCAAGGACGGGAGGGTCTCCGTCGCCAAGGAG
GCCAGCAAGGTGCCGGTTGGTCACGAGAACGGTCACGAGAACGTCACGTCTCTCCTCCAGCTTTTCCAATCCGAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GCGCGCACACG
ATAGGGCGAAGCACCTGCGGGTCCATCCAATCGCGGCTCTACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGG
GCGTCGGAGTACGTGTACCTCGACGGGAGGACGCCGAAAACCTTCGACAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCC
CGGACCGGGCCCCTCGTGTCGGCGCTCGCCACCCAGCCCGAGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTC
CGCACCAACTGCAACGCCGTCAACCGCTACTGA

Retrieve as FASTA