Entry information : EcamPrx33 (EcS739446.10)
Entry ID 10372
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status partial
Reviewer Qiang Li
Last annotation changes 2013-02-06 (Qiang Li)
Peroxidase information: EcamPrx33 (EcS739446.10)
Name (synonym) EcamPrx33 (EcS739446.10)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx33
start..stop
S start..stop
EglPrx33 186 6e-61 1..93 87..179
EgrPrx33 186 1e-60 1..93 87..179
EgrPrx36 185 2e-60 1..93 87..179
EgrPrx39 184 8e-60 1..93 87..179
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..165 165 N° 2 356..469 114  
join(1..165,356..469)


exon

Literature and cross-references EcamPrx33 (EcS739446.10)
Protein sequence: EcamPrx33 (EcS739446.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   93
PWM (Da):   %s   9608.83  
PI (pH):   %s   4.3
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TPTIDSEKLAVPNNNSARGFEVIDQIKAEVDKACGYSLVSCADILAVAARDSVVALGGPSWEVQLGRRDSTTASRTTANSDIPAPNMDLPALI

Retrieve as FASTA  
Remarks Partial sequence from genomic. Incorrect prediction from kazusa (Two ends are missing due to short contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCCCAACCATTGACAGCGAAAAGCTCGCCGTCCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGCGGATACTCACTTGTATCA
TGTGCCGACATCTTGGCCGTCGCAGCCCGTGACTCGGTAGTTGCG
GTATGTCTTATCTTAATGCTACATATGATGCGATGCCTTCATTTAAGCAAAACTACAGTGCAGACAAATAGAAGA
GAGAGTCTCCCGCTAATTGAACACGCTAGGCGTAGAATCATATGCACATACATAATCTTTCGATTATCTAAGCAAAGCTGAATTTGAACTTAAAAGGTTGACTGAAATATTTCAGCTGGG
AGGGCCTTCATGGGAAGTACAACTTGGAAGGAGGGACTCGACCACGGCGAGCAGGACAACCGCCAACTCCGACATTCCCGCGCCGAACATGGACTTGCCTGCACTGATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACCCCAACCATTGACAGCGAAAAGCTCGCCGTCCCGAATAACAATTCGGCTAGAGGGTTCGAAGTGATCGATCAAATTAAGGCGGAGGTCGACAAAGCTTGCGGATACTCACTTGTATCA
TGTGCCGACATCTTGGCCGTCGCAGCCCGTGACTCGGTAGTTGCG
CTGGGAGGGCCTTCATGGGAAGTACAACTTGGAAGGAGGGACTCGACCACGGCGAGCAGGACAACCGCCAACTCC
GACATTCCCGCGCCGAACATGGACTTGCCTGCACTGATC

Retrieve as FASTA