Entry information : EcamAPx[P]05 ( EcS763192.10)
Entry ID 10376
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EcamAPx[P]05 ( EcS763192.10)
Name (synonym) EcamAPx[P]05 ( EcS763192.10)
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamAPx[P]05
start..stop
S start..stop
EguAPx[P]05 162 4e-54 1..78 1..78
EguAPx[P]02 159 1e-53 1..78 1..78
EgrAPx[P]02 159 1e-53 1..78 1..78
EgrAPx[P]05 159 5e-53 1..78 1..78
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..51 51 N° 2 138..217 80 N° 3 330..432 103  
join(1..51,138..217,330..432)


exon

Literature and cross-references EcamAPx[P]05 ( EcS763192.10)
Protein sequence: EcamAPx[P]05 ( EcS763192.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   78
PWM (Da):   %s   8558.37  
PI (pH):   %s   4.73
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSDKDIVALSGAHTLGRAHQERSGFDGPWTQEPLKFDNSYFVELLKGEAEGLLKLPTDKALLENPAFRPYVELYA

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from kazusa (3' end is missing due to short contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTTGTTATTTT
TTTATTCTTGTGTCTAGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAATTCCTATTTTGTGTAAGATTTCATCTTTTCACTGG
ATAAGATTTCATCTTTTCACTGGATGCATTTTCTAAGTTTCGGCTGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGACACAGCGAGTTGTTGAAAGGGGAAGCAGAGGGGCTG
CTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTAAGTTTGATAAT
TCCTATTTTGT
CGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG

Retrieve as FASTA