Entry information : EcamPrx[P]166 ( EcS764190.10)
Entry ID 10377
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2012-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EcamPrx[P]166 ( EcS764190.10)
Name (synonym) EcamPrx[P]166 ( EcS764190.10)
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]166
start..stop
S start..stop
EgrPrx[P]166 428 5e-154 1..220 68..319
EglPrx[P]166 427 5e-154 1..220 46..297
EguPrx[P]166 422 2e-151 1..220 68..319
EglPrx167 404 7e-146 1..220 3..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2..112 111 N° 2 246..794 549  
join(2..112,246..794)


exon

Literature and cross-references EcamPrx[P]166 ( EcS764190.10)
Protein sequence: EcamPrx[P]166 ( EcS764190.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   23278.81  
PI (pH):   %s   9.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RGFNVIDTIKSKVEKLCPGVVSCADILAVVARDSVVELGGRSWQVQLGRRDSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVTFRNRLYNENDISSSFATSLKVQCPSSGGDNNLSPLDITSPTSFDSAYFSNLVSQKGLLHSDQQLFSGGSTNAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRTNCKRVN

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from kazusa (5' end is missing due to the ending of contig). Close to EcC047020.20 and EcC059954.10 (Removed).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGGGATTTAACGTGATTGACACCATCAAGTCAAAAGTGGAGAAATTATGCCCCGGCGTCGTCTCATGCGCCGACATCCTAGCTGTTGTTGCTAGGGACTCCGTCGTTGAAGTAAGTGCC
CAACCCTGGAAATTTCTTGGAACGTAATTTTATTATTGATCACTAATGGAATATACTTTTGAAGCAATACAAAGAAACTACGAGTTTTCTAAACTTATATGGATTCATTGAATTTGATCT
TCAGTTGGGTGGACGGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCGACCACTGCGAGCTTAAACGCTGCCAATACCAACCTTCCAGCTCCAACTCTCAATCTCAGTGCCCTTATCAC
CTCTTTCTCTAACAAGGGCTTCACTGCTAAAGAAATGGTGGCACTTTCAGGATCTCACACAATAGGCCAGGCTAGGTGTGTGACGTTCCGGAACCGACTCTACAATGAGAATGACATAAG
CTCGTCGTTCGCCACATCTTTAAAGGTCCAGTGCCCCAGCTCGGGAGGTGACAACAACCTCTCTCCTCTCGACATCACGAGCCCGACGTCCTTCGACAGTGCCTACTTCAGCAACTTGGT
GAGCCAAAAGGGCTTGCTTCATTCGGACCAACAATTGTTCAGTGGGGGCTCGACGAACGCTCAAGTGACTACCTACAGCAAGAACTTGGATTTGTTCAAGAACGATTTTGCCAAGGCCAT
GGTCAAGATGGGAGGCCTTAGCCCTCTCACCGGGTCTGCTGGTCAGATCAGGACGAATTGTAAAAGAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGGGATTTAACGTGATTGACACCATCAAGTCAAAAGTGGAGAAATTATGCCCCGGCGTCGTCTCATGCGCCGACATCCTAGCTGTTGTTGCTAGGGACTCCGTCGTTGAATTGGGTGGA
CGGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCGACCACTGCGAGCTTAAACGCTGCCAATACCAACCTTCCAGCTCCAACTCTCAATCTCAGTGCCCTTATCACCTCTTTCTCTAAC
AAGGGCTTCACTGCTAAAGAAATGGTGGCACTTTCAGGATCTCACACAATAGGCCAGGCTAGGTGTGTGACGTTCCGGAACCGACTCTACAATGAGAATGACATAAGCTCGTCGTTCGCC
ACATCTTTAAAGGTCCAGTGCCCCAGCTCGGGAGGTGACAACAACCTCTCTCCTCTCGACATCACGAGCCCGACGTCCTTCGACAGTGCCTACTTCAGCAACTTGGTGAGCCAAAAGGGC
TTGCTTCATTCGGACCAACAATTGTTCAGTGGGGGCTCGACGAACGCTCAAGTGACTACCTACAGCAAGAACTTGGATTTGTTCAAGAACGATTTTGCCAAGGCCATGGTCAAGATGGGA
GGCCTTAGCCCTCTCACCGGGTCTGCTGGTCAGATCAGGACGAATTGTAAAAGAGTCAAC

Retrieve as FASTA