Entry information : OsPrx28
Entry ID 1038
Creation 2005-06-16 (Filippo Passardi)
Last sequence changes 2005-06-16 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-08-03 (Marie Brette (Scipio))
Peroxidase information: OsPrx28
Name OsPrx28
Class Class III peroxidase     [Orthogroup: Prx018]*
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx28
start..stop
S start..stop
SiPrx77 464 4e-166 4..333 2..320
BdiPrx99 457 2e-163 36..333 24..319
SbPrx74 454 4e-162 5..334 2..326
OsPrx30 451 7e-161 4..334 2..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7958881..7959123 243 N° 2 7959225..7959422 198 N° 3 7959520..7960083 564  
join(7958881..7959123,7959225..7959422,7959520..7960083)


exon

Literature and cross-references OsPrx28
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6ER46
DNA ref. GenBank:   NC_008395.1 (7958881..7960080)
Protein sequence: OsPrx28
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   334 (307)
PWM (Da):   %s   35330.71 (32639.3)  
PI (pH):   %s   7.26 (6.87) Peptide Signal:   %s   cut: 28 range:28-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAASSTTTRFCLLLALVLPMISSAAAGDDALPLPMTPSYYRKSCPTLEAIVRGTMLSAIKAERRMGASILRLFFHDCFVQGCDASILLDDVPSKGFVGEKTAGPNTNSIRGYEVIDKIKANVEAACPGVVSCADILALAAREGVNLLGGPSWEVPLGRRDSTTASKSEADSDLPGPSSSLADLVAAFGKKGLAPRDMTALSGAHTIGYAQCQFFRGHIYNDTNVDPLFAAERRRRCPAASGSGDSNLAPLDDMTALAFDNAYYRDLVGRRGLLHSDQELFNGGSQDERVKKYSTDPDLFAGDFVAAMIKMGKICPLTGAAGQIRKNCRVVNSS*

Retrieve as FASTA  
Remarks chromosome 2; no ESTs (NIAS DNA database and TIGR)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCTTCGTCTACTACGACTCGTTTTTGCCTTCTCCTTGCGCTCGTCCTGCCGATGATTTCCTCCGCCGCCGCCGGCGACGACGCGCTGCCGCTGCCCATGACACCGTCGTAC
TACCGCAAGTCGTGCCCAACACTCGAGGCCATCGTGCGCGGCACCATGCTCAGTGCCATCAAAGCCGAGCGCCGGATGGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTC
CAG
GTAGATGATCCTAGCTAAGCTTCATTTCTTCCTGCTCATTGGGCGGATGATCTATGGAGATCTTGAAGCAATGCAAGCTCACATTGCTTGTGATTGATCAGGGTTGCGATGCATCGA
TTCTTCTCGACGACGTGCCGTCGAAGGGGTTCGTCGGCGAGAAGACCGCGGGGCCCAACACCAACTCCATCCGCGGCTACGAGGTCATCGACAAGATCAAGGCCAACGTCGAGGCCGCCT
GCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGAAGGCGTCAACCTG
GTATGTACGTGTTTGGTTACCGCGTTTGGTTACCGATGGTGATTTCGGGGCCGGTTTC
GTAACAACATTTCTGCACTGCACACGCAATGCAATGCAGCTCGGCGGGCCGAGCTGGGAGGTGCCGCTGGGGCGGCGCGACTCGACGACGGCGAGCAAGAGCGAGGCGGACAGCGACCTG
CCGGGGCCGTCGTCCAGCCTCGCCGACCTCGTCGCGGCGTTCGGCAAGAAGGGCCTGGCGCCGCGCGACATGACGGCGCTCTCCGGCGCGCACACCATCGGCTACGCCCAGTGCCAGTTC
TTCCGCGGCCACATCTACAACGACACCAACGTCGACCCGCTGTTCGCCGCCGAGCGCCGCCGCCGCTGCCCCGCCGCGTCCGGCTCCGGCGACTCCAACCTGGCGCCGCTCGACGACATG
ACGGCGCTCGCCTTCGACAACGCCTACTACCGCGACCTGGTCGGCCGCCGCGGCCTGCTCCACTCCGACCAGGAGCTCTTCAACGGCGGCTCGCAGGACGAGCGGGTGAAGAAGTACAGC
ACCGACCCGGACCTCTTCGCCGGCGACTTCGTGGCGGCGATGATAAAGATGGGGAAGATATGCCCGCTCACCGGAGCAGCCGGCCAGATCAGGAAGAACTGCAGGGTGGTCAACAGCAGC
TGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTGCAGCTTCGTCTACTACGACTCGTTTTTGCCTTCTCCTTGCGCTCGTCCTGCCGATGATTTCCTCCGCCGCCGCCGGCGACGACGCGCTGCCGCTGCCCATGACACCGTCGTAC
TACCGCAAGTCGTGCCCAACACTCGAGGCCATCGTGCGCGGCACCATGCTCAGTGCCATCAAAGCCGAGCGCCGGATGGGCGCCTCCATCCTCCGCCTCTTCTTCCACGACTGCTTCGTC
CAG
GGTTGCGATGCATCGATTCTTCTCGACGACGTGCCGTCGAAGGGGTTCGTCGGCGAGAAGACCGCGGGGCCCAACACCAACTCCATCCGCGGCTACGAGGTCATCGACAAGATCAAG
GCCAACGTCGAGGCCGCCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCCTCGCCGCCCGCGAAGGCGTCAACCTG
CTCGGCGGGCCGAGCTGGGAGGTGCCGCTGGGGCGGCGC
GACTCGACGACGGCGAGCAAGAGCGAGGCGGACAGCGACCTGCCGGGGCCGTCGTCCAGCCTCGCCGACCTCGTCGCGGCGTTCGGCAAGAAGGGCCTGGCGCCGCGCGACATGACGGCG
CTCTCCGGCGCGCACACCATCGGCTACGCCCAGTGCCAGTTCTTCCGCGGCCACATCTACAACGACACCAACGTCGACCCGCTGTTCGCCGCCGAGCGCCGCCGCCGCTGCCCCGCCGCG
TCCGGCTCCGGCGACTCCAACCTGGCGCCGCTCGACGACATGACGGCGCTCGCCTTCGACAACGCCTACTACCGCGACCTGGTCGGCCGCCGCGGCCTGCTCCACTCCGACCAGGAGCTC
TTCAACGGCGGCTCGCAGGACGAGCGGGTGAAGAAGTACAGCACCGACCCGGACCTCTTCGCCGGCGACTTCGTGGCGGCGATGATAAAGATGGGGAAGATATGCCCGCTCACCGGAGCA
GCCGGCCAGATCAGGAAGAACTGCAGGGTGGTCAACAGCAGCTGA

Retrieve as FASTA