Entry information : EcamPrx[P]170 ( EcC010500.10)
Entry ID 10385
Creation 2012-01-30 (Qiang Li)
Last sequence changes 2013-02-06 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EcamPrx[P]170 ( EcC010500.10)
Name (synonym) EcamPrx[P]170 ( EcC010500.10)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus camaldulensis    [TaxId: 34316 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EcamPrx[P]170
start..stop
S start..stop
EgrPrx[P]170 302 2e-107 1..158 1..158
EguPrx[P]170 267 7e-94 1..158 1..149
EglPrx[P]170 205 5e-70 54..158 1..105
EcamPrx[P]166 183 1e-59 1..158 42..217
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..438 438 N° 2 472..507 36  
join(1..438,472..507)


exon

Literature and cross-references EcamPrx[P]170 ( EcC010500.10)
Protein sequence: EcamPrx[P]170 ( EcC010500.10)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   158
PWM (Da):   %s   17631.79  
PI (pH):   %s   9.71
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SWQVQLGRRISSMTNLSAANTDILAPTLNFNDLITSFYNKGFTTKEMMALSGSHTIGNARCTTIQSWLHNESNINLSFAPPPRHHEPYVLRQFCNLVNQKGLLRLDLQLFSGNSMNDQVTIYINILNLFWSDFANAMVKMGGLSPLTGSSNRIRMNCR

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from kazusa (5' end is missing due to the ending of contig).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTTGGCAAGTTCAGCTGGGAAGAAGAATTTCGTCCATGACGAACCTAAGCGCCGCTAATACTGATATCCTAGCTCCAACTCTTAATTTCAACGACCTCATCACTTCTTTCTATAACAAA
GGATTCACTACCAAAGAAATGATGGCACTCTCGGGATCCCACACCATAGGCAACGCTAGGTGCACAACGATCCAATCCTGGCTCCACAATGAGAGCAACATAAACTTGTCGTTCGCCCCA
CCCCCGCGGCATCATGAGCCGTACGTCCTTCGACAATTCTGCAACTTGGTAAACCAAAAGGGCCTACTCCGCTTGGATCTGCAATTGTTTAGTGGGAATTCAATGAACGATCAAGTGACC
ATCTACATCAACATTTTGAATTTGTTCTGGAGCGACTTTGCTAATGCCATGGTCAAGATGGGAGGCCTTAGCCCTCTC
GCCGGTTTTTTTTTAAAATCGGTCAGACCTCTCACCGGGTCT
AGCAATCGGATAAGAATGAACTGCAGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGTTGGCAAGTTCAGCTGGGAAGAAGAATTTCGTCCATGACGAACCTAAGCGCCGCTAATACTGATATCCTAGCTCCAACTCTTAATTTCAACGACCTCATCACTTCTTTCTATAACAAA
GGATTCACTACCAAAGAAATGATGGCACTCTCGGGATCCCACACCATAGGCAACGCTAGGTGCACAACGATCCAATCCTGGCTCCACAATGAGAGCAACATAAACTTGTCGTTCGCCCCA
CCCCCGCGGCATCATGAGCCGTACGTCCTTCGACAATTCTGCAACTTGGTAAACCAAAAGGGCCTACTCCGCTTGGATCTGCAATTGTTTAGTGGGAATTCAATGAACGATCAAGTGACC
ATCTACATCAACATTTTGAATTTGTTCTGGAGCGACTTTGCTAATGCCATGGTCAAGATGGGAGGCCTTAGCCCTCTC
ACCGGGTCTAGCAATCGGATAAGAATGAACTGCAGG

Retrieve as FASTA